BLASTX nr result
ID: Atractylodes21_contig00041045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00041045 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAV92898.1| Avr9/Cf-9 rapidly elicited protein 102, partial [... 60 2e-07 gb|AFP55581.1| ATP binding protein [Rosa rugosa] 56 3e-06 >gb|AAV92898.1| Avr9/Cf-9 rapidly elicited protein 102, partial [Nicotiana tabacum] Length = 258 Score = 60.1 bits (144), Expect = 2e-07 Identities = 32/59 (54%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = +3 Query: 18 KLMHSGSTRTVEESGDSGLFCMENMHTGKELKKLYGLLRNRSRRKE-SFDLDGGEGKSS 191 +L SGS RTVEE+GDSG+FC +++ +E KKLYGLLR RS RK+ SF+ D + +S Sbjct: 199 RLSESGSVRTVEETGDSGIFCKDSV---REFKKLYGLLRIRSSRKDSSFEFDTSDKDNS 254 >gb|AFP55581.1| ATP binding protein [Rosa rugosa] Length = 490 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +3 Query: 3 VDLPSKLMHSGSTRTVEESGDSG-LFCMENMHTGKELKKLYGLLRNRSRRKE 155 V + L SGS R+V+ESG+ G +FC E++HT +E +KLYGLLR SRRKE Sbjct: 415 VKVAQALTSSGSGRSVDESGEPGTVFCRESVHTVREFRKLYGLLRLGSRRKE 466