BLASTX nr result
ID: Atractylodes21_contig00040992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040992 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 71 8e-11 ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 70 2e-10 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355504658|gb|AES85861.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355507098|gb|AES88240.1| hypothetical protein MTR_4g051230 [Medicago truncatula] Length = 95 Score = 71.2 bits (173), Expect = 8e-11 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 125 MAKLVDATDLIGLSLGMETY*VITFKFRETLELIKMGNPEP 3 MAKLVDATDLIGLSLGMETY V TFKFRETLEL KMGNPEP Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEP 40 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 69.7 bits (169), Expect = 2e-10 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 125 MAKLVDATDLIGLSLGMETY*VITFKFRETLELIKMGNPEP 3 MA+LVDATDLIGLSLGMETY V TFKFRETLEL KMGNPEP Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEP 40