BLASTX nr result
ID: Atractylodes21_contig00040974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040974 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29444.3| unnamed protein product [Vitis vinifera] 82 3e-14 ref|XP_002309970.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 ref|NP_001237692.1| uncharacterized protein LOC100306366 precurs... 74 9e-12 ref|XP_002306302.1| predicted protein [Populus trichocarpa] gi|2... 74 9e-12 ref|XP_002532873.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 >emb|CBI29444.3| unnamed protein product [Vitis vinifera] Length = 157 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/51 (74%), Positives = 40/51 (78%) Frame = -1 Query: 195 CFLLQINLSKTTHIRGLLYEEKTRLGSTPPSCHNKCNICHPCMAVQVPTMP 43 CF Q T RGLL+EEKTRLGSTPPSCHNKCN CHPCMAVQVPT+P Sbjct: 50 CFSQQQGSDST---RGLLFEEKTRLGSTPPSCHNKCNECHPCMAVQVPTLP 97 >ref|XP_002309970.1| predicted protein [Populus trichocarpa] gi|222852873|gb|EEE90420.1| predicted protein [Populus trichocarpa] Length = 126 Score = 75.9 bits (185), Expect = 3e-12 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -1 Query: 150 GLLYEEKTRLGSTPPSCHNKCNICHPCMAVQVPTMPGRVRRGQ 22 G +EEK RLGSTPPSCHNKCN CHPCMAVQVPT+P + R Q Sbjct: 40 GAAFEEKARLGSTPPSCHNKCNGCHPCMAVQVPTLPNQNRPAQ 82 >ref|NP_001237692.1| uncharacterized protein LOC100306366 precursor [Glycine max] gi|255628317|gb|ACU14503.1| unknown [Glycine max] Length = 127 Score = 74.3 bits (181), Expect = 9e-12 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 153 RGLLYEEKTRLGSTPPSCHNKCNICHPCMAVQVPTMP 43 R LL+EEK RLGS PPSCHNKCN CHPCMAVQVPT+P Sbjct: 43 RELLFEEKNRLGSIPPSCHNKCNDCHPCMAVQVPTLP 79 >ref|XP_002306302.1| predicted protein [Populus trichocarpa] gi|222855751|gb|EEE93298.1| predicted protein [Populus trichocarpa] Length = 128 Score = 74.3 bits (181), Expect = 9e-12 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = -1 Query: 177 NLSKTTHIRGLLYEEKTRLGSTPPSCHNKCNICHPCMAVQVPTMPGRVRRGQM 19 +L T +G+ +EEK RLGSTPPSCHNKCN CHPC+AVQVP +P + QM Sbjct: 34 HLQPPTSPQGIAFEEKARLGSTPPSCHNKCNGCHPCIAVQVPALPSQNEPVQM 86 >ref|XP_002532873.1| conserved hypothetical protein [Ricinus communis] gi|223527358|gb|EEF29502.1| conserved hypothetical protein [Ricinus communis] Length = 88 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 150 GLLYEEKTRLGSTPPSCHNKCNICHPCMAVQVPTMPGRVR 31 G +E+KTRLGSTPPSCHNKCN CHPCMAVQVPT+P R Sbjct: 6 GFDFEDKTRLGSTPPSCHNKCNGCHPCMAVQVPTVPSHNR 45