BLASTX nr result
ID: Atractylodes21_contig00040946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040946 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624320.1| Flavonol synthase/flavanone 3-hydroxylase [M... 56 3e-06 >ref|XP_003624320.1| Flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula] gi|355499335|gb|AES80538.1| Flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula] Length = 351 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = -1 Query: 227 IHRATVNMERKRFSIASVHSLPIEKKVGPTPQLVDEQYPIA 105 IHRA VN + KRFSI S+HSL ++KK+GP +LVD+Q+P++ Sbjct: 282 IHRAIVNEDEKRFSIVSLHSLAMDKKIGPALELVDDQHPMS 322