BLASTX nr result
ID: Atractylodes21_contig00040934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040934 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003590348.1| Zinc finger MYM-type 1 [Medicago truncatula]... 60 2e-07 gb|AAF82236.1|AC069143_12 Contains similarity to a transposable ... 58 7e-07 ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerizat... 58 7e-07 ref|XP_002319808.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_003589867.1| hypothetical protein MTR_1g040620 [Medicago ... 55 6e-06 >ref|XP_003590348.1| Zinc finger MYM-type 1 [Medicago truncatula] gi|355479396|gb|AES60599.1| Zinc finger MYM-type 1 [Medicago truncatula] Length = 368 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = -3 Query: 139 KQSRVEINLSELPADPGLRIRILDYDPNIRDKVRRAYLLKGPCQLR 2 K+ +E++L +LP+DPGLR R+LDY P+ R+K+RR Y KGPCQ R Sbjct: 37 KKRWLELDLGKLPSDPGLRPRLLDYHPSDREKIRRYYFQKGPCQPR 82 >gb|AAF82236.1|AC069143_12 Contains similarity to a transposable element Tip100 protein for transposase from Ipomoea purpurea gb|4063769 and is a member of the transmembrane 4 family PF|00335 [Arabidopsis thaliana] Length = 811 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 124 EINLSELPADPGLRIRILDYDPNIRDKVRRAYLLKGPCQLR 2 +INL+ELP+DP R IL Y PN RD+VRR YL++GPCQ R Sbjct: 56 DINLNELPSDPAKRKSILSYHPNQRDEVRREYLIRGPCQPR 96 >ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] gi|332191703|gb|AEE29824.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] Length = 769 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 124 EINLSELPADPGLRIRILDYDPNIRDKVRRAYLLKGPCQLR 2 +INL+ELP+DP R IL Y PN RD+VRR YL++GPCQ R Sbjct: 14 DINLNELPSDPAKRKSILSYHPNQRDEVRREYLIRGPCQPR 54 >ref|XP_002319808.1| predicted protein [Populus trichocarpa] gi|222858184|gb|EEE95731.1| predicted protein [Populus trichocarpa] Length = 788 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -3 Query: 145 SCKQSRVEINLSELPADPGLRIRILDYDPNIRDKVRRAYLLKGPCQ 8 S K+S +EIN L ADPGLR I +Y N RD +RRAYL KGPCQ Sbjct: 28 SSKKSHIEINPDTLLADPGLRRPIYEYHINDRDAIRRAYLQKGPCQ 73 >ref|XP_003589867.1| hypothetical protein MTR_1g040620 [Medicago truncatula] gi|355478915|gb|AES60118.1| hypothetical protein MTR_1g040620 [Medicago truncatula] Length = 665 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -3 Query: 145 SCKQSRVEINLSELPADPGLRIRILDYDPNIRDKVRRAYLLKGPCQ 8 S K +E++L LPA+PG R ++ Y PN RD++RRAYL KGPCQ Sbjct: 31 SFKNGFLEVDLENLPANPGERKQLSCYHPNDRDEIRRAYLAKGPCQ 76