BLASTX nr result
ID: Atractylodes21_contig00040902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040902 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003619618.1| Receptor-like protein kinase [Medicago trunc... 136 2e-30 ref|XP_003548248.1| PREDICTED: somatic embryogenesis receptor ki... 134 8e-30 ref|XP_003534047.1| PREDICTED: probable leucine-rich repeat rece... 132 2e-29 ref|XP_002318874.1| predicted protein [Populus trichocarpa] gi|2... 132 3e-29 ref|XP_004170265.1| PREDICTED: probable leucine-rich repeat rece... 132 4e-29 >ref|XP_003619618.1| Receptor-like protein kinase [Medicago truncatula] gi|355494633|gb|AES75836.1| Receptor-like protein kinase [Medicago truncatula] Length = 720 Score = 136 bits (343), Expect = 2e-30 Identities = 66/83 (79%), Positives = 73/83 (87%) Frame = -2 Query: 249 GQVANISLQGKGLSGKLSPAFSELKHLTGLYLHYNSLSGGFPKELFNLTELSDLYLNVNN 70 GQVAN+SLQGKGLSGKLSPA +LKHLTGLYLHYNSL G PKE+ NLT+LSDLYLNVN+ Sbjct: 71 GQVANVSLQGKGLSGKLSPAIGDLKHLTGLYLHYNSLYGDIPKEIANLTQLSDLYLNVNH 130 Query: 69 LSGSIPMELGNMENLQVLQLSYD 1 LSG IP E+G MENLQVLQL Y+ Sbjct: 131 LSGEIPSEIGKMENLQVLQLCYN 153 >ref|XP_003548248.1| PREDICTED: somatic embryogenesis receptor kinase 4-like [Glycine max] Length = 684 Score = 134 bits (337), Expect = 8e-30 Identities = 66/83 (79%), Positives = 73/83 (87%) Frame = -2 Query: 249 GQVANISLQGKGLSGKLSPAFSELKHLTGLYLHYNSLSGGFPKELFNLTELSDLYLNVNN 70 GQVAN+SLQGKGLSGKLSPA + LKHLTGLYLHYNSL G P+E+ NLTELSDLYLNVN+ Sbjct: 71 GQVANVSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSLYGEIPREVANLTELSDLYLNVNH 130 Query: 69 LSGSIPMELGNMENLQVLQLSYD 1 LSG IP E+G MENLQVLQL Y+ Sbjct: 131 LSGEIPPEIGKMENLQVLQLCYN 153 >ref|XP_003534047.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Glycine max] Length = 683 Score = 132 bits (333), Expect = 2e-29 Identities = 66/83 (79%), Positives = 73/83 (87%) Frame = -2 Query: 249 GQVANISLQGKGLSGKLSPAFSELKHLTGLYLHYNSLSGGFPKELFNLTELSDLYLNVNN 70 GQVAN+SLQGKGLSGKLSPA + LKHLTGLYLHYNSL G P+EL NLTELSDLYLNVN+ Sbjct: 70 GQVANVSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSLYGEIPRELANLTELSDLYLNVNH 129 Query: 69 LSGSIPMELGNMENLQVLQLSYD 1 LSG IP E+G ME+LQVLQL Y+ Sbjct: 130 LSGEIPPEIGMMESLQVLQLCYN 152 >ref|XP_002318874.1| predicted protein [Populus trichocarpa] gi|222859547|gb|EEE97094.1| predicted protein [Populus trichocarpa] Length = 648 Score = 132 bits (332), Expect = 3e-29 Identities = 65/84 (77%), Positives = 73/84 (86%) Frame = -2 Query: 252 NGQVANISLQGKGLSGKLSPAFSELKHLTGLYLHYNSLSGGFPKELFNLTELSDLYLNVN 73 NGQVANISLQGKGL+GK+SPA + LK+LTGLYLHYNSL G P+E+ NLT LSDLYLNVN Sbjct: 36 NGQVANISLQGKGLNGKVSPAITGLKYLTGLYLHYNSLYGEIPREIANLTALSDLYLNVN 95 Query: 72 NLSGSIPMELGNMENLQVLQLSYD 1 NLSG IP E+GNM NLQVLQL Y+ Sbjct: 96 NLSGEIPPEIGNMANLQVLQLCYN 119 >ref|XP_004170265.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Cucumis sativus] Length = 679 Score = 132 bits (331), Expect = 4e-29 Identities = 65/83 (78%), Positives = 71/83 (85%) Frame = -2 Query: 249 GQVANISLQGKGLSGKLSPAFSELKHLTGLYLHYNSLSGGFPKELFNLTELSDLYLNVNN 70 GQV N+SLQGKGLSGKLSPA + LKHLTGLYLHYNSL G PKE+ NLT LSDLYLNVNN Sbjct: 67 GQVTNMSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSLFGDIPKEIANLTLLSDLYLNVNN 126 Query: 69 LSGSIPMELGNMENLQVLQLSYD 1 SG IP E+GNME+LQVLQL Y+ Sbjct: 127 FSGEIPSEIGNMESLQVLQLCYN 149