BLASTX nr result
ID: Atractylodes21_contig00040640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040640 (496 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531364.1| Zeamatin precursor, putative [Ricinus commun... 57 1e-06 gb|AAO12209.1| thaumatin-like cytokinin-binding protein [Brassic... 57 2e-06 ref|XP_004150181.1| PREDICTED: osmotin-like protein-like [Cucumi... 55 5e-06 >ref|XP_002531364.1| Zeamatin precursor, putative [Ricinus communis] gi|223529024|gb|EEF31012.1| Zeamatin precursor, putative [Ricinus communis] Length = 254 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 3/35 (8%) Frame = -3 Query: 464 TGCTHYNT---CATGNCVGKLECNGLGGATPATLA 369 TGCTHYN CATG+C ++ECNGLGGATPATLA Sbjct: 86 TGCTHYNGKFHCATGDCNHQIECNGLGGATPATLA 120 >gb|AAO12209.1| thaumatin-like cytokinin-binding protein [Brassica oleracea] Length = 250 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/37 (67%), Positives = 30/37 (81%), Gaps = 3/37 (8%) Frame = -3 Query: 470 GPTGCTHYN---TCATGNCVGKLECNGLGGATPATLA 369 G TGC+HYN +C TG+C +LECNGLGGATPA+LA Sbjct: 81 GRTGCSHYNGKFSCVTGDCGHRLECNGLGGATPASLA 117 >ref|XP_004150181.1| PREDICTED: osmotin-like protein-like [Cucumis sativus] gi|449524076|ref|XP_004169049.1| PREDICTED: osmotin-like protein-like [Cucumis sativus] Length = 255 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/35 (77%), Positives = 29/35 (82%), Gaps = 3/35 (8%) Frame = -3 Query: 464 TGCT-HYN--TCATGNCVGKLECNGLGGATPATLA 369 TGCT H+N TCATG+C GKLECNG GG TPATLA Sbjct: 87 TGCTGHHNHLTCATGDCGGKLECNGAGGKTPATLA 121