BLASTX nr result
ID: Atractylodes21_contig00040608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040608 (460 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518631.1| conserved hypothetical protein [Ricinus comm... 68 7e-10 >ref|XP_002518631.1| conserved hypothetical protein [Ricinus communis] gi|223542230|gb|EEF43773.1| conserved hypothetical protein [Ricinus communis] Length = 796 Score = 68.2 bits (165), Expect = 7e-10 Identities = 42/98 (42%), Positives = 56/98 (57%), Gaps = 2/98 (2%) Frame = -3 Query: 413 ESAMETVLRSRKRKQQSTKSDPFSGIFTRSKEQIYLHRHRSGYARADSIRNRSLIQRQRT 234 E ++ + + R+R S+ S P GIFTRSK +IYLH +RSG AR+DS R I +Q Sbjct: 2 EETLQIISKKRRRSSSSSSSHPLMGIFTRSKSKIYLHCNRSGRARSDSSR----INKQNP 57 Query: 233 ATKSLVSQVPSKATSDHI--TNQVSVKDLRARRVFSPA 126 + P + S I + V +KDLRARRVFS A Sbjct: 58 VGLQSKEKKPRQKDSSDIGEWSCVVIKDLRARRVFSLA 95