BLASTX nr result
ID: Atractylodes21_contig00040564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040564 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago ... 119 3e-30 ref|XP_003628497.1| NADH dehydrogenase subunit F [Medicago trunc... 59 5e-07 >ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago truncatula] gi|355477332|gb|AES58535.1| hypothetical protein MTR_1g005250 [Medicago truncatula] Length = 197 Score = 119 bits (298), Expect(2) = 3e-30 Identities = 61/78 (78%), Positives = 62/78 (79%) Frame = -2 Query: 236 GRTCDGSQGSNMTTSLRSTLPRYCSMEAGGLLEVRPAFFCVVGEGLTFLTHIQSYRHGPT 57 GRTCDGS SN+ L Y SMEAGGLLEVRP FF VVGEGLTFLTHI SYRHGPT Sbjct: 89 GRTCDGSPRSNIYDHLGLRCHDYFSMEAGGLLEVRPGFFGVVGEGLTFLTHIHSYRHGPT 148 Query: 56 DFFSIGASSSATRFYLTK 3 D FSIGASSSATRFYLTK Sbjct: 149 DLFSIGASSSATRFYLTK 166 Score = 37.7 bits (86), Expect(2) = 3e-30 Identities = 20/27 (74%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = -1 Query: 354 PAGLVWLFFSIE-KESAVCASHLLLGS 277 PAGLVWLF SIE KESAVCA GS Sbjct: 69 PAGLVWLFLSIEKKESAVCAGRTCDGS 95 >ref|XP_003628497.1| NADH dehydrogenase subunit F [Medicago truncatula] gi|355522519|gb|AET02973.1| NADH dehydrogenase subunit F [Medicago truncatula] Length = 187 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -1 Query: 354 PAGLVWLFFSIEK-ESAVCASHLLLGSAGRHGIL 256 PAGLVWLF SIEK ESAVCASHLLLGSAGRH + Sbjct: 51 PAGLVWLFLSIEKKESAVCASHLLLGSAGRHAFV 84