BLASTX nr result
ID: Atractylodes21_contig00040546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040546 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547809.1| PREDICTED: uncharacterized protein LOC100819... 90 2e-16 ref|XP_003635012.1| PREDICTED: uncharacterized protein LOC100852... 89 3e-16 ref|XP_003635011.1| PREDICTED: uncharacterized protein LOC100852... 89 3e-16 emb|CBI40815.3| unnamed protein product [Vitis vinifera] 89 3e-16 ref|XP_002521082.1| hypothetical protein RCOM_1719530 [Ricinus c... 89 3e-16 >ref|XP_003547809.1| PREDICTED: uncharacterized protein LOC100819018 [Glycine max] Length = 262 Score = 90.1 bits (222), Expect = 2e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 229 NCCVCMVRHKGAAFIPCGHTFCRLCSRELFVQRASCPLCNN 107 NCCVCMVRHKGAAFIPCGHTFCR+CSRE++V R +CPLCNN Sbjct: 213 NCCVCMVRHKGAAFIPCGHTFCRMCSREIWVSRGNCPLCNN 253 >ref|XP_003635012.1| PREDICTED: uncharacterized protein LOC100852917 isoform 2 [Vitis vinifera] gi|359495533|ref|XP_003635013.1| PREDICTED: uncharacterized protein LOC100852917 isoform 3 [Vitis vinifera] Length = 335 Score = 89.4 bits (220), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 229 NCCVCMVRHKGAAFIPCGHTFCRLCSRELFVQRASCPLCN 110 NCCVCMVRHKGAAFIPCGHTFCRLCSREL+V R +CPLCN Sbjct: 286 NCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCN 325 >ref|XP_003635011.1| PREDICTED: uncharacterized protein LOC100852917 isoform 1 [Vitis vinifera] Length = 329 Score = 89.4 bits (220), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 229 NCCVCMVRHKGAAFIPCGHTFCRLCSRELFVQRASCPLCN 110 NCCVCMVRHKGAAFIPCGHTFCRLCSREL+V R +CPLCN Sbjct: 280 NCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCN 319 >emb|CBI40815.3| unnamed protein product [Vitis vinifera] Length = 317 Score = 89.4 bits (220), Expect = 3e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 229 NCCVCMVRHKGAAFIPCGHTFCRLCSRELFVQRASCPLCN 110 NCCVCMVRHKGAAFIPCGHTFCRLCSREL+V R +CPLCN Sbjct: 268 NCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCN 307 >ref|XP_002521082.1| hypothetical protein RCOM_1719530 [Ricinus communis] gi|223539651|gb|EEF41233.1| hypothetical protein RCOM_1719530 [Ricinus communis] Length = 370 Score = 89.4 bits (220), Expect = 3e-16 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 232 NNCCVCMVRHKGAAFIPCGHTFCRLCSRELFVQRASCPLCN 110 + CCVCMVRHKGAAFIPCGHTFCRLCSREL+VQR +CPLCN Sbjct: 320 HTCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCN 360