BLASTX nr result
ID: Atractylodes21_contig00040531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040531 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264188.2| PREDICTED: putative cyclin-B3-1-like [Vitis ... 62 4e-08 >ref|XP_002264188.2| PREDICTED: putative cyclin-B3-1-like [Vitis vinifera] Length = 673 Score = 62.4 bits (150), Expect = 4e-08 Identities = 41/120 (34%), Positives = 62/120 (51%), Gaps = 18/120 (15%) Frame = +2 Query: 11 RKSLPVLMLHDKAEESDIKKGNKDNKLNKENHDFLVKPKAGTMVVPQINTNHERRWKNRA 190 RKSLPV+ +K + SD+K+ + ++ K FLVK KAG V+PQ+ +NRA Sbjct: 191 RKSLPVIRRVNKVDRSDLKENVETSEQGKGKSSFLVKTKAGEKVIPQVRNTRTNLLRNRA 250 Query: 191 SDGCIKMAS--QLTGDKQRLSR--------------LSMKPTVKTTV--GNPKAQRVSRT 316 SDG I MAS Q D + + + ++PT++TTV N + QR ++ Sbjct: 251 SDGFILMASRRQTNVDAHAIPKRPIRFQLFELFLYFIEIQPTLRTTVKTSNVQTQRTLKS 310