BLASTX nr result
ID: Atractylodes21_contig00040000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040000 (693 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524379.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 >ref|XP_002524379.1| conserved hypothetical protein [Ricinus communis] gi|223536340|gb|EEF37990.1| conserved hypothetical protein [Ricinus communis] Length = 302 Score = 60.5 bits (145), Expect = 3e-07 Identities = 33/81 (40%), Positives = 44/81 (54%) Frame = -1 Query: 258 KMKEQYLDIPYSGRIKSWCNEFLLITDLDREGSLYIYNLITKEGSFLPPCSTSCGGHYGC 79 +M + +P GRI S CN LL+ + +G LY+ NL+TK LPPC T+C H C Sbjct: 54 QMPRSFYVLPRIGRISSSCNGVLLVNNTHEDGWLYVINLVTKCHIILPPCPTNC-PHKAC 112 Query: 78 KCGVGLSFDEFKGVYKVVHVF 16 VG F YKVVH++ Sbjct: 113 GSAVG--FYPRSKQYKVVHIY 131