BLASTX nr result
ID: Atractylodes21_contig00039993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00039993 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN51065.1| basic helix-loop-helix protein [Sesamum indicum] 55 6e-06 >gb|ABN51065.1| basic helix-loop-helix protein [Sesamum indicum] Length = 400 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = -2 Query: 415 TAPLHPIHPQPVWDNDLHNLLQMGFDANPSINNLGPNGGAKMDL 284 TAP PQ +W+N+L N+LQ G+D+NPS+ +LGP+G +KM+L Sbjct: 357 TAPQFQSLPQNLWNNELQNILQNGYDSNPSVGSLGPSGLSKMEL 400