BLASTX nr result
ID: Atractylodes21_contig00039670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00039670 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE59439.1| hypothetical protein OsJ_11614 [Oryza sativa Japo... 59 4e-07 gb|EEC75665.1| hypothetical protein OsI_12456 [Oryza sativa Indi... 59 4e-07 ref|XP_003545104.1| PREDICTED: DUF21 domain-containing protein A... 59 5e-07 ref|XP_003519620.1| PREDICTED: DUF21 domain-containing protein A... 59 5e-07 gb|AEL99188.1| CBS domain and transporter associated domain-cont... 59 5e-07 >gb|EEE59439.1| hypothetical protein OsJ_11614 [Oryza sativa Japonica Group] Length = 701 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 396 WLSLVLYPVGRVVTFLSMGMLKILGLKGKRQVFL 295 WLSLVLYPVGR+VTFLSMGML+ILGLKG+ + ++ Sbjct: 288 WLSLVLYPVGRIVTFLSMGMLQILGLKGRSEPYV 321 >gb|EEC75665.1| hypothetical protein OsI_12456 [Oryza sativa Indica Group] Length = 502 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 396 WLSLVLYPVGRVVTFLSMGMLKILGLKGKRQVFL 295 WLSLVLYPVGR+VTFLSMGML+ILGLKG+ + ++ Sbjct: 109 WLSLVLYPVGRIVTFLSMGMLQILGLKGRSEPYV 142 >ref|XP_003545104.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like [Glycine max] Length = 665 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -3 Query: 396 WLSLVLYPVGRVVTFLSMGMLKILGLKGKRQVFL 295 WLSLVLYPVGR+VT+LSMGMLK+LGLKG+ + ++ Sbjct: 287 WLSLVLYPVGRIVTYLSMGMLKLLGLKGRSEPYV 320 >ref|XP_003519620.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like [Glycine max] Length = 666 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -3 Query: 396 WLSLVLYPVGRVVTFLSMGMLKILGLKGKRQVFL 295 WLSLVLYPVGR+VT+LSMGMLK+LGLKG+ + ++ Sbjct: 288 WLSLVLYPVGRIVTYLSMGMLKLLGLKGRSEPYV 321 >gb|AEL99188.1| CBS domain and transporter associated domain-containing protein, partial [Silene latifolia] Length = 545 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 396 WLSLVLYPVGRVVTFLSMGMLKILGLKGKRQVFL 295 WLSLVLYPVGRVVT+LSMGMLK+LGLKG+ + ++ Sbjct: 197 WLSLVLYPVGRVVTYLSMGMLKMLGLKGRSEPYV 230