BLASTX nr result
ID: Atractylodes21_contig00039662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00039662 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134353.1| PREDICTED: brefeldin A-inhibited guanine nuc... 78 9e-13 ref|XP_002877273.1| predicted protein [Arabidopsis lyrata subsp.... 75 4e-12 ref|XP_002516179.1| guanine nucleotide-exchange, putative [Ricin... 75 4e-12 ref|XP_002309445.1| predicted protein [Populus trichocarpa] gi|2... 75 6e-12 ref|XP_003609924.1| Brefeldin A-inhibited guanine nucleotide-exc... 75 7e-12 >ref|XP_004134353.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Cucumis sativus] gi|449480318|ref|XP_004155860.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Cucumis sativus] Length = 1783 Score = 77.8 bits (190), Expect = 9e-13 Identities = 39/87 (44%), Positives = 53/87 (60%) Frame = -3 Query: 303 VWDSEGQPTSYNITGSQWLPIPAGLSVLTSNSLSKVNNGALEESFHSRNEKRSNFLSSFW 124 + D+E ++++T W P+ AGLS LTS+ +V + ALE F NE+ S F SFW Sbjct: 1223 IHDNESAEPAFDMTEHYWFPMLAGLSDLTSDPRPEVRSCALEVLFDLLNERGSKFSMSFW 1282 Query: 123 ESILHCISVPIFDHICHAGKEITSCGG 43 ESI H + PIFDH+ HAGKE + G Sbjct: 1283 ESIFHRVLFPIFDHLRHAGKESVNSSG 1309 >ref|XP_002877273.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297323111|gb|EFH53532.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 1758 Score = 75.5 bits (184), Expect = 4e-12 Identities = 41/87 (47%), Positives = 53/87 (60%) Frame = -3 Query: 321 PGIPMEVWDSEGQPTSYNITGSQWLPIPAGLSVLTSNSLSKVNNGALEESFHSRNEKRSN 142 PG ++ DS T +++T W P+ AGLS LTS+ +V N ALE F NE+ + Sbjct: 1234 PGGVLKPVDSNEDET-FDVTEHYWFPMLAGLSDLTSDFRPEVRNCALEVLFDLLNERGNK 1292 Query: 141 FLSSFWESILHCISVPIFDHICHAGKE 61 F + FWESI H I PIFDH+ HAGKE Sbjct: 1293 FSTPFWESIFHRILFPIFDHVSHAGKE 1319 >ref|XP_002516179.1| guanine nucleotide-exchange, putative [Ricinus communis] gi|223544665|gb|EEF46181.1| guanine nucleotide-exchange, putative [Ricinus communis] Length = 1714 Score = 75.5 bits (184), Expect = 4e-12 Identities = 40/87 (45%), Positives = 55/87 (63%) Frame = -3 Query: 321 PGIPMEVWDSEGQPTSYNITGSQWLPIPAGLSVLTSNSLSKVNNGALEESFHSRNEKRSN 142 PG ++ D+ T +++T W P+ AGLS LTS++ +V + ALE F NE+ S Sbjct: 1225 PGGALKPIDANVDAT-FDVTEHYWFPMLAGLSDLTSDARPEVRSCALEVLFDLLNERGSK 1283 Query: 141 FLSSFWESILHCISVPIFDHICHAGKE 61 F +SFWESI H + PIFDH+ HAGKE Sbjct: 1284 FSTSFWESIFHRVLFPIFDHVRHAGKE 1310 >ref|XP_002309445.1| predicted protein [Populus trichocarpa] gi|222855421|gb|EEE92968.1| predicted protein [Populus trichocarpa] Length = 1323 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/72 (51%), Positives = 48/72 (66%) Frame = -3 Query: 276 SYNITGSQWLPIPAGLSVLTSNSLSKVNNGALEESFHSRNEKRSNFLSSFWESILHCISV 97 ++++T W P+ AGLS LTS+ +V + ALE F NE+ S F SSFWESI H + Sbjct: 1070 NFDVTEHYWFPMLAGLSDLTSDLRPEVRSCALEVLFDLLNERGSKFSSSFWESIFHRVLF 1129 Query: 96 PIFDHICHAGKE 61 PIFDH+ HAGKE Sbjct: 1130 PIFDHVRHAGKE 1141 >ref|XP_003609924.1| Brefeldin A-inhibited guanine nucleotide-exchange protein [Medicago truncatula] gi|355510979|gb|AES92121.1| Brefeldin A-inhibited guanine nucleotide-exchange protein [Medicago truncatula] Length = 1937 Score = 74.7 bits (182), Expect = 7e-12 Identities = 37/73 (50%), Positives = 47/73 (64%) Frame = -3 Query: 279 TSYNITGSQWLPIPAGLSVLTSNSLSKVNNGALEESFHSRNEKRSNFLSSFWESILHCIS 100 T+ ++T W P+ AGLS LTS+ +V + ALE F NE+ S F SFWESI H + Sbjct: 1289 TTLDVTEHYWFPMLAGLSDLTSDQRPEVRSCALEVLFDLLNERGSKFSKSFWESIFHRVL 1348 Query: 99 VPIFDHICHAGKE 61 PIFDH+ HAGKE Sbjct: 1349 FPIFDHVRHAGKE 1361