BLASTX nr result
ID: Atractylodes21_contig00039539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00039539 (193 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAZ64538.1| inward rectifying shaker-like K+ channel [Vitis ... 116 2e-24 ref|XP_002281787.1| PREDICTED: potassium channel AKT1-like [Viti... 116 2e-24 emb|CBI28150.3| unnamed protein product [Vitis vinifera] 116 2e-24 ref|XP_004149890.1| PREDICTED: potassium channel AKT1-like [Cucu... 116 2e-24 ref|XP_002308313.1| predicted protein [Populus trichocarpa] gi|2... 116 2e-24 >emb|CAZ64538.1| inward rectifying shaker-like K+ channel [Vitis vinifera] Length = 872 Score = 116 bits (291), Expect = 2e-24 Identities = 53/62 (85%), Positives = 60/62 (96%) Frame = +1 Query: 7 ELEQMSRDGSHYSLTTGVLPSLGARSNRRVKLRSFIISPYDRRYRSWETFLVALVLYTAW 186 E+EQ+SRDGSHYSL+TG+LPSLGARSNRRVKLR+FI+SPYDRRYR+WETFLV LV YTAW Sbjct: 19 EIEQLSRDGSHYSLSTGILPSLGARSNRRVKLRNFILSPYDRRYRTWETFLVLLVFYTAW 78 Query: 187 VS 192 VS Sbjct: 79 VS 80 >ref|XP_002281787.1| PREDICTED: potassium channel AKT1-like [Vitis vinifera] Length = 872 Score = 116 bits (291), Expect = 2e-24 Identities = 53/62 (85%), Positives = 60/62 (96%) Frame = +1 Query: 7 ELEQMSRDGSHYSLTTGVLPSLGARSNRRVKLRSFIISPYDRRYRSWETFLVALVLYTAW 186 E+EQ+SRDGSHYSL+TG+LPSLGARSNRRVKLR+FI+SPYDRRYR+WETFLV LV YTAW Sbjct: 19 EIEQLSRDGSHYSLSTGILPSLGARSNRRVKLRNFILSPYDRRYRTWETFLVLLVFYTAW 78 Query: 187 VS 192 VS Sbjct: 79 VS 80 >emb|CBI28150.3| unnamed protein product [Vitis vinifera] Length = 872 Score = 116 bits (291), Expect = 2e-24 Identities = 53/62 (85%), Positives = 60/62 (96%) Frame = +1 Query: 7 ELEQMSRDGSHYSLTTGVLPSLGARSNRRVKLRSFIISPYDRRYRSWETFLVALVLYTAW 186 E+EQ+SRDGSHYSL+TG+LPSLGARSNRRVKLR+FI+SPYDRRYR+WETFLV LV YTAW Sbjct: 19 EIEQLSRDGSHYSLSTGILPSLGARSNRRVKLRNFILSPYDRRYRTWETFLVLLVFYTAW 78 Query: 187 VS 192 VS Sbjct: 79 VS 80 >ref|XP_004149890.1| PREDICTED: potassium channel AKT1-like [Cucumis sativus] Length = 873 Score = 116 bits (290), Expect = 2e-24 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = +1 Query: 4 QELEQMSRDGSHYSLTTGVLPSLGARSNRRVKLRSFIISPYDRRYRSWETFLVALVLYTA 183 +ELEQ+SRDGS YSLTTG+LPSLGARSNRRVKLR FIISPYDRRYR WETFLV LV+YTA Sbjct: 18 EELEQLSRDGSQYSLTTGILPSLGARSNRRVKLRRFIISPYDRRYRIWETFLVVLVVYTA 77 Query: 184 WVS 192 WVS Sbjct: 78 WVS 80 >ref|XP_002308313.1| predicted protein [Populus trichocarpa] gi|222854289|gb|EEE91836.1| predicted protein [Populus trichocarpa] Length = 848 Score = 116 bits (290), Expect = 2e-24 Identities = 54/63 (85%), Positives = 59/63 (93%) Frame = +1 Query: 4 QELEQMSRDGSHYSLTTGVLPSLGARSNRRVKLRSFIISPYDRRYRSWETFLVALVLYTA 183 +ELE++SRDGSHYSLTTG+LPSLGARSNRRVKL FIISPYDRRYR WETFLV LV+YTA Sbjct: 18 EELERLSRDGSHYSLTTGILPSLGARSNRRVKLNRFIISPYDRRYRIWETFLVVLVIYTA 77 Query: 184 WVS 192 WVS Sbjct: 78 WVS 80