BLASTX nr result
ID: Atractylodes21_contig00039512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00039512 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140551.1| PREDICTED: uncharacterized protein At2g33490... 56 3e-06 >ref|XP_004140551.1| PREDICTED: uncharacterized protein At2g33490-like [Cucumis sativus] gi|449528537|ref|XP_004171260.1| PREDICTED: uncharacterized protein At2g33490-like [Cucumis sativus] Length = 642 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = +2 Query: 200 MKSPFIKVRRLGLHRHDKHDRQAIQRSFAQLDELSQASQDMENMRECYD 346 MK+ F K R GLH+H+ DR + R AQLDEL+QAS+ ME MR+CYD Sbjct: 1 MKTSFRKFRGFGLHKHEPKDRVDL-RPLAQLDELAQASRRMEEMRDCYD 48