BLASTX nr result
ID: Atractylodes21_contig00039360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00039360 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617143.1| Oligoribonuclease [Medicago truncatula] gi|3... 57 1e-06 >ref|XP_003617143.1| Oligoribonuclease [Medicago truncatula] gi|355518478|gb|AET00102.1| Oligoribonuclease [Medicago truncatula] Length = 1551 Score = 57.4 bits (137), Expect = 1e-06 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = +3 Query: 105 GAPEEEDWENARCFIEYLRIFFNVTKKVSGSNYVTA 212 G P DW+NA+CF+++L++FF +TKKVSGS YVT+ Sbjct: 1311 GVPNNVDWDNAKCFVKFLKLFFEITKKVSGSTYVTS 1346