BLASTX nr result
ID: Atractylodes21_contig00039265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00039265 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531340.1| Frataxin, mitochondrial precursor, putative ... 91 1e-16 ref|XP_002872789.1| hypothetical protein ARALYDRAFT_490236 [Arab... 89 3e-16 ref|NP_192233.2| frataxin [Arabidopsis thaliana] gi|83302740|sp|... 89 4e-16 gb|AAD14452.1| putative frataxin-like protein [Arabidopsis thali... 89 4e-16 ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform 1... 86 2e-15 >ref|XP_002531340.1| Frataxin, mitochondrial precursor, putative [Ricinus communis] gi|223529062|gb|EEF31047.1| Frataxin, mitochondrial precursor, putative [Ricinus communis] Length = 200 Score = 90.5 bits (223), Expect = 1e-16 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = -1 Query: 239 QIWMSSPVSGPSRFDWDRTAEAWIYRRTKAKLLETLENEIQQLCGEPITLS 87 Q+W+SSPVSGPSR+DWDR AEAW+YRRTKA L E LE+E++Q+CGEPI L+ Sbjct: 150 QLWLSSPVSGPSRYDWDRNAEAWVYRRTKANLFEVLESELEQVCGEPIKLA 200 >ref|XP_002872789.1| hypothetical protein ARALYDRAFT_490236 [Arabidopsis lyrata subsp. lyrata] gi|297318626|gb|EFH49048.1| hypothetical protein ARALYDRAFT_490236 [Arabidopsis lyrata subsp. lyrata] Length = 186 Score = 89.4 bits (220), Expect = 3e-16 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -1 Query: 239 QIWMSSPVSGPSRFDWDRTAEAWIYRRTKAKLLETLENEIQQLCGEPITLS 87 QIWMSSPVSGPSRFDWDR A AWIYRRT+AKL + LE E+++LCGEPI LS Sbjct: 136 QIWMSSPVSGPSRFDWDRDANAWIYRRTEAKLHKLLEEELEKLCGEPIQLS 186 >ref|NP_192233.2| frataxin [Arabidopsis thaliana] gi|83302740|sp|Q9ZR07.2|FRDA_ARATH RecName: Full=Frataxin, mitochondrial; Short=Fxn; Flags: Precursor gi|48958525|gb|AAT47815.1| At4g03240 [Arabidopsis thaliana] gi|51860727|gb|AAU11485.1| mitochondrial frataxin-like [Arabidopsis thaliana] gi|51971038|dbj|BAD44211.1| putative frataxin-like protein [Arabidopsis thaliana] gi|51971859|dbj|BAD44594.1| putative frataxin-like protein [Arabidopsis thaliana] gi|332656896|gb|AEE82296.1| frataxin [Arabidopsis thaliana] Length = 187 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -1 Query: 239 QIWMSSPVSGPSRFDWDRTAEAWIYRRTKAKLLETLENEIQQLCGEPITLS 87 QIWMSSPVSGPSRFDWDR A AWIYRRT+AKL + LE E++ LCGEPI LS Sbjct: 137 QIWMSSPVSGPSRFDWDRDANAWIYRRTEAKLHKLLEEELENLCGEPIQLS 187 >gb|AAD14452.1| putative frataxin-like protein [Arabidopsis thaliana] gi|7270194|emb|CAB77809.1| putative frataxin-like protein [Arabidopsis thaliana] Length = 143 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -1 Query: 239 QIWMSSPVSGPSRFDWDRTAEAWIYRRTKAKLLETLENEIQQLCGEPITLS 87 QIWMSSPVSGPSRFDWDR A AWIYRRT+AKL + LE E++ LCGEPI LS Sbjct: 93 QIWMSSPVSGPSRFDWDRDANAWIYRRTEAKLHKLLEEELENLCGEPIQLS 143 >ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform 1 [Vitis vinifera] gi|296081250|emb|CBI17994.3| unnamed protein product [Vitis vinifera] Length = 197 Score = 86.3 bits (212), Expect = 2e-15 Identities = 36/51 (70%), Positives = 46/51 (90%) Frame = -1 Query: 239 QIWMSSPVSGPSRFDWDRTAEAWIYRRTKAKLLETLENEIQQLCGEPITLS 87 QIW+SSPVSGPSRFDWD++A+AW+YRRTKA L + LE E+++LCG PI+LS Sbjct: 147 QIWLSSPVSGPSRFDWDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 197