BLASTX nr result
ID: Atractylodes21_contig00039138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00039138 (543 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003598883.1| hypothetical protein MTR_3g022950 [Medicago ... 56 3e-06 >ref|XP_003598883.1| hypothetical protein MTR_3g022950 [Medicago truncatula] gi|355487931|gb|AES69134.1| hypothetical protein MTR_3g022950 [Medicago truncatula] Length = 840 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/68 (41%), Positives = 40/68 (58%) Frame = +3 Query: 339 LSLNIRGIGGKHKGDWVRSLQREHNIKFIAIQETQFSITGNINANSLWNNSPFDFDVVES 518 +S N+RG+GG K V +L RE N + +QE++ S+ +I LWN++ DF S Sbjct: 655 ISWNVRGLGGFEKRREVSNLVREKNPFILCLQESKLSVVNDIVCKGLWNDNHVDFSFQPS 714 Query: 519 QGRSGGLI 542 G SGGLI Sbjct: 715 SGASGGLI 722