BLASTX nr result
ID: Atractylodes21_contig00039076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00039076 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554287.1| PREDICTED: U-box domain-containing protein 3... 73 2e-11 ref|XP_002306856.1| predicted protein [Populus trichocarpa] gi|2... 73 2e-11 ref|XP_002302042.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 ref|XP_003520603.1| PREDICTED: U-box domain-containing protein 3... 71 8e-11 ref|XP_002532036.1| ubiquitin-protein ligase, putative [Ricinus ... 71 1e-10 >ref|XP_003554287.1| PREDICTED: U-box domain-containing protein 3-like [Glycine max] Length = 775 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 310 GAVPPLVALSQSGTSRAKEKAQQLLSHFRSQREKASGRGKS 188 GAVPPLVALSQSGT RAKEKAQQLLSHFR+QRE A+G+GKS Sbjct: 735 GAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKS 775 >ref|XP_002306856.1| predicted protein [Populus trichocarpa] gi|222856305|gb|EEE93852.1| predicted protein [Populus trichocarpa] Length = 748 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 310 GAVPPLVALSQSGTSRAKEKAQQLLSHFRSQREKASGRGKS 188 GAVPPLVALSQSGT RAKEKAQQLLSHFRSQRE ++G+GKS Sbjct: 708 GAVPPLVALSQSGTPRAKEKAQQLLSHFRSQREGSAGKGKS 748 >ref|XP_002302042.1| predicted protein [Populus trichocarpa] gi|222843768|gb|EEE81315.1| predicted protein [Populus trichocarpa] Length = 753 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 310 GAVPPLVALSQSGTSRAKEKAQQLLSHFRSQREKASGRGKS 188 GAVPPLVALSQSGT RAKEKAQQLLSHFRSQRE ++G+G+S Sbjct: 713 GAVPPLVALSQSGTPRAKEKAQQLLSHFRSQREASAGKGRS 753 >ref|XP_003520603.1| PREDICTED: U-box domain-containing protein 3-like [Glycine max] Length = 759 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 310 GAVPPLVALSQSGTSRAKEKAQQLLSHFRSQREKASGRGKS 188 GAVPPLVALSQSGT RAKEKAQQLLSHFR+QRE G+GKS Sbjct: 719 GAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGVKGKGKS 759 >ref|XP_002532036.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223528306|gb|EEF30352.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 753 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 310 GAVPPLVALSQSGTSRAKEKAQQLLSHFRSQREKASGRGKS 188 GAVPPLVALSQSGT RAKEKAQQLLSHFR+QRE + G+GKS Sbjct: 713 GAVPPLVALSQSGTLRAKEKAQQLLSHFRNQREGSMGKGKS 753