BLASTX nr result
ID: Atractylodes21_contig00038409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00038409 (516 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317294.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 ref|XP_002519637.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_003607806.1| hypothetical protein MTR_4g083110 [Medicago ... 58 7e-07 ref|XP_003616235.1| hypothetical protein MTR_5g077640 [Medicago ... 56 3e-06 ref|XP_002525962.1| hypothetical protein RCOM_0596970 [Ricinus c... 56 3e-06 >ref|XP_002317294.1| predicted protein [Populus trichocarpa] gi|222860359|gb|EEE97906.1| predicted protein [Populus trichocarpa] Length = 84 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/74 (39%), Positives = 49/74 (66%) Frame = -1 Query: 417 EVAPPQFVSLMRQRTTKMLDTISEDEREVSMNEREAKVTAVRSSLSSAPSHKATSGNSTH 238 E APPQ++S+MR RT+KMLDTISE++R+V+ ++ + S++ + + + NST+ Sbjct: 12 EAAPPQYISVMRHRTSKMLDTISEEDRDVAASD-PFPMAPTSSTIVTTSATSVAAKNSTY 70 Query: 237 FFGQTQRKFTVLGN 196 FF +R F++ N Sbjct: 71 FFKGIRRSFSLFAN 84 >ref|XP_002519637.1| conserved hypothetical protein [Ricinus communis] gi|223541054|gb|EEF42610.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 58.5 bits (140), Expect = 5e-07 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 4/78 (5%) Frame = -1 Query: 417 EVAPPQFVSLMRQRTTKMLDTISEDEREVSMNEREAKVTAVRSSLS----SAPSHKATSG 250 EVAPPQ++S++R+R +KMLDTI+E+ER+VS + A +S S SA + + Sbjct: 12 EVAPPQYISVIRRRASKMLDTINEEERDVSPSNSLASAPTSPASASTNAASASAAAPVAT 71 Query: 249 NSTHFFGQTQRKFTVLGN 196 NS +F + QR F+V N Sbjct: 72 NSKYFPRRVQRSFSVFQN 89 >ref|XP_003607806.1| hypothetical protein MTR_4g083110 [Medicago truncatula] gi|355508861|gb|AES90003.1| hypothetical protein MTR_4g083110 [Medicago truncatula] Length = 85 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/76 (39%), Positives = 52/76 (68%), Gaps = 2/76 (2%) Frame = -1 Query: 417 EVAPPQFVSLMRQRTTKMLDTISEDEREVSMNEREAKVTAVRSSLSSAPSHKATSG--NS 244 EVAPPQ+VS+MR RT+KM++TI+ED+RE+ N ++ ++ +SSL+S+ + +T+ N+ Sbjct: 12 EVAPPQYVSVMRHRTSKMMETITEDDREI--NSNDSVISPPKSSLASSLAASSTNATVNT 69 Query: 243 THFFGQTQRKFTVLGN 196 F + R + L + Sbjct: 70 RDFLKEVHRTLSSLNH 85 >ref|XP_003616235.1| hypothetical protein MTR_5g077640 [Medicago truncatula] gi|355517570|gb|AES99193.1| hypothetical protein MTR_5g077640 [Medicago truncatula] Length = 89 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/78 (37%), Positives = 49/78 (62%), Gaps = 4/78 (5%) Frame = -1 Query: 417 EVAPPQFVSLMRQRTTKMLDTISEDEREVSMNEREAKVTAVRSSLSSAPSHKATSG---- 250 EVAPPQ+VS+MRQR + M++TI+E++RE+S ++ + S +S++ S A+S Sbjct: 12 EVAPPQYVSVMRQRASNMMETITEEDREISSHDNLISLPKSSSVISASSSACASSTNARV 71 Query: 249 NSTHFFGQTQRKFTVLGN 196 N+ +F + R + L N Sbjct: 72 NTRYFLNEVHRTLSSLNN 89 >ref|XP_002525962.1| hypothetical protein RCOM_0596970 [Ricinus communis] gi|223534694|gb|EEF36386.1| hypothetical protein RCOM_0596970 [Ricinus communis] Length = 79 Score = 55.8 bits (133), Expect = 3e-06 Identities = 31/72 (43%), Positives = 44/72 (61%) Frame = -1 Query: 417 EVAPPQFVSLMRQRTTKMLDTISEDEREVSMNEREAKVTAVRSSLSSAPSHKATSGNSTH 238 EVAPPQ++S+MR R +KMLDTI+E+ER+VS + +SL+SAPSH + Sbjct: 12 EVAPPQYISVMRHRASKMLDTINEEERDVSPS----------NSLASAPSHMVLASEVAQ 61 Query: 237 FFGQTQRKFTVL 202 Q + +VL Sbjct: 62 VKQQNDGRKSVL 73