BLASTX nr result
ID: Atractylodes21_contig00038349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00038349 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634572.1| PREDICTED: metal tolerance protein 9-like [V... 74 1e-11 emb|CBI39365.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_003533894.1| PREDICTED: metal tolerance protein 10-like [... 67 2e-09 gb|AAO38709.1| cation diffusion facilitator 10 [Stylosanthes ham... 62 6e-08 ref|XP_003546823.1| PREDICTED: metal tolerance protein 10-like [... 61 8e-08 >ref|XP_003634572.1| PREDICTED: metal tolerance protein 9-like [Vitis vinifera] Length = 350 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = +1 Query: 223 GKHGKVQEYYKKQKRLLERYNEMETINESGCLPGSLTEDEMNDL 354 GK GKV EYYKKQ+RLLE YNEMETIN GCLPG LTEDE+ L Sbjct: 13 GKKGKVAEYYKKQERLLEAYNEMETINSMGCLPGRLTEDELKQL 56 >emb|CBI39365.3| unnamed protein product [Vitis vinifera] Length = 392 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = +1 Query: 226 KHGKVQEYYKKQKRLLERYNEMETINESGCLPGSLTEDEMNDL 354 K GKV EYYKKQ+RLLE YNEMETIN GCLPG LTEDE+ L Sbjct: 56 KKGKVAEYYKKQERLLEAYNEMETINSMGCLPGRLTEDELKQL 98 >ref|XP_003533894.1| PREDICTED: metal tolerance protein 10-like [Glycine max] Length = 410 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +1 Query: 226 KHGKVQEYYKKQKRLLERYNEMETINESGCLPGSLTEDEMNDL 354 K KV EYYKKQ+RLLE YN+M+T+ E+GC PGSLTEDEM L Sbjct: 74 KQRKVAEYYKKQERLLEGYNDMDTMTETGCFPGSLTEDEMKQL 116 >gb|AAO38709.1| cation diffusion facilitator 10 [Stylosanthes hamata] Length = 413 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 226 KHGKVQEYYKKQKRLLERYNEMETINESGCLPGSLTEDEMNDL 354 K KV EYYKKQ+RLLE +NEM+T+ E+G PGSLTEDEM L Sbjct: 77 KQRKVAEYYKKQERLLEGFNEMDTMAETGFFPGSLTEDEMKQL 119 >ref|XP_003546823.1| PREDICTED: metal tolerance protein 10-like [Glycine max] Length = 396 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +1 Query: 226 KHGKVQEYYKKQKRLLERYNEMETINESGCLPGSLTEDEMNDL 354 K KV EYY KQ+RLLE +NEMET+ E+G PGSLTEDEM L Sbjct: 60 KQRKVAEYYNKQERLLEGFNEMETMTETGGFPGSLTEDEMKQL 102