BLASTX nr result
ID: Atractylodes21_contig00038306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00038306 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274937.2| PREDICTED: uncharacterized protein LOC100260... 56 3e-06 emb|CBI24209.3| unnamed protein product [Vitis vinifera] 56 3e-06 emb|CAN78969.1| hypothetical protein VITISV_022739 [Vitis vinifera] 56 3e-06 >ref|XP_002274937.2| PREDICTED: uncharacterized protein LOC100260139 [Vitis vinifera] Length = 1976 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 97 MEFVGRTLKKEFKGFGVFTGVVKSYDSSSGFF 2 MEFVGR +KKEF GFG+F+G+VKSYD SGFF Sbjct: 1 MEFVGRPVKKEFHGFGIFSGLVKSYDPESGFF 32 >emb|CBI24209.3| unnamed protein product [Vitis vinifera] Length = 1805 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 97 MEFVGRTLKKEFKGFGVFTGVVKSYDSSSGFF 2 MEFVGR +KKEF GFG+F+G+VKSYD SGFF Sbjct: 1 MEFVGRPVKKEFHGFGIFSGLVKSYDPESGFF 32 >emb|CAN78969.1| hypothetical protein VITISV_022739 [Vitis vinifera] Length = 1318 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 97 MEFVGRTLKKEFKGFGVFTGVVKSYDSSSGFF 2 MEFVGR +KKEF GFG+F+G+VKSYD SGFF Sbjct: 1 MEFVGRPVKKEFHGFGIFSGLVKSYDPESGFF 32