BLASTX nr result
ID: Atractylodes21_contig00038233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00038233 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627258.1| Metallophosphoesterase [Medicago truncatula]... 55 8e-06 >ref|XP_003627258.1| Metallophosphoesterase [Medicago truncatula] gi|355521280|gb|AET01734.1| Metallophosphoesterase [Medicago truncatula] Length = 650 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -1 Query: 163 NQEIHQGKVE-DDLKVTMVADLLLSGHEDRAAYLDLHFKDFYFSRFFRKSFEFLK 2 N + + + E D+LKV MVADLLL G E A Y++ F+D Y S+FFRKSFE LK Sbjct: 30 NNHVEEAEAEADELKVMMVADLLLLGSE--AGYVNRFFRDHYMSKFFRKSFENLK 82