BLASTX nr result
ID: Atractylodes21_contig00038185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00038185 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAR86717.1| zinc finger protein [Populus euphratica] 93 2e-17 ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula... 89 5e-16 ref|XP_002523006.1| conserved hypothetical protein [Ricinus comm... 87 2e-15 ref|XP_002520031.1| conserved hypothetical protein [Ricinus comm... 66 3e-09 >gb|AAR86717.1| zinc finger protein [Populus euphratica] Length = 218 Score = 93.2 bits (230), Expect = 2e-17 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = +3 Query: 42 RCSETPRADHTERHESAGNASWQSGVKHP*RYEKRGRDDIIDVRTAP 182 RCSETP ADHTERHESAGNASW+SGVKHP RYEKRGRDDII VRTAP Sbjct: 10 RCSETPSADHTERHESAGNASWRSGVKHPMRYEKRGRDDIIYVRTAP 56 >ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula] gi|355477331|gb|AES58534.1| Cytochrome c biogenesis [Medicago truncatula] Length = 860 Score = 88.6 bits (218), Expect = 5e-16 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +1 Query: 40 LAARKHPVLTTLRDTKAQVMPVGKVALSIPSGTKREVVMISSTSVPL 180 LAARKHPVLTTLR+TKAQVMPVG+VALSIPSGTKREVVMISSTSVPL Sbjct: 297 LAARKHPVLTTLRETKAQVMPVGEVALSIPSGTKREVVMISSTSVPL 343 >ref|XP_002523006.1| conserved hypothetical protein [Ricinus communis] gi|223537818|gb|EEF39436.1| conserved hypothetical protein [Ricinus communis] Length = 58 Score = 86.7 bits (213), Expect = 2e-15 Identities = 45/53 (84%), Positives = 47/53 (88%) Frame = +1 Query: 22 RKGKVCLAARKHPVLTTLRDTKAQVMPVGKVALSIPSGTKREVVMISSTSVPL 180 R G V +ARKHPVLTTLRDTKAQV PVG+VALSIPSGTKREVVMISST VPL Sbjct: 3 RGGGVSFSARKHPVLTTLRDTKAQVTPVGEVALSIPSGTKREVVMISSTFVPL 55 >ref|XP_002520031.1| conserved hypothetical protein [Ricinus communis] gi|223540795|gb|EEF42355.1| conserved hypothetical protein [Ricinus communis] Length = 231 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +3 Query: 60 RADHTERHESAGNASWQSGVKHP*RYEKRGRDDIIDVRTAP 182 R +HTERHESAGN SW+SGVKH RYEKRGRDDII + P Sbjct: 68 RVNHTERHESAGNTSWRSGVKHLKRYEKRGRDDIIYICITP 108