BLASTX nr result
ID: Atractylodes21_contig00038067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00038067 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533404.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatul... 58 9e-07 ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatul... 57 2e-06 gb|AFK45340.1| unknown [Medicago truncatula] 55 6e-06 >ref|XP_002533404.1| conserved hypothetical protein [Ricinus communis] gi|223526749|gb|EEF28977.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +2 Query: 26 VNPKTQFSGNFFGFLPKRKTPLPTSGPSRKHNDIGPQSWRVP 151 V PK Q G+F FLP R P+PTSGPSR+HNDIG QSWR P Sbjct: 47 VKPKNQHRGHFLNFLP-RHFPIPTSGPSRRHNDIGLQSWRSP 87 >ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|222838042|gb|EEE76407.1| predicted protein [Populus trichocarpa] Length = 78 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = +2 Query: 5 SDHVFRVVNPKTQFSGNFFGFLPKRKTPLPTSGPSRKHNDIGPQSWRVP 151 S +VF PKTQ+ G+F FLP R P+PTSGPSR+HN IG Q+WR P Sbjct: 32 STNVFNF-KPKTQYKGHFLNFLP-RHLPIPTSGPSRRHNGIGLQNWRSP 78 >ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatula] gi|357519903|ref|XP_003630240.1| Protein IDA-like protein [Medicago truncatula] gi|355524220|gb|AET04674.1| Protein IDA-like protein [Medicago truncatula] gi|355524262|gb|AET04716.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +2 Query: 26 VNPKTQFSGNFFGFLPKRKTPLPTSGPSRKHNDIGPQSWRVP 151 V PK++ G+FFGFLPKR +P S PSRKHNDIG +SWR P Sbjct: 36 VKPKSEHQGHFFGFLPKRMH-IPYSTPSRKHNDIGLRSWRSP 76 >ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatula] gi|355491609|gb|AES72812.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +2 Query: 11 HVFRVVNPKTQFSGNFFGFLPKRKTPLPTSGPSRKHNDIGPQSWRVP 151 +VF+V PK + G+FFGFLP+R P+P S PSRKHNDIG QS R P Sbjct: 32 NVFKV-KPKYEHKGHFFGFLPRR-IPIPYSSPSRKHNDIGLQSLRSP 76 >gb|AFK45340.1| unknown [Medicago truncatula] Length = 76 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = +2 Query: 11 HVFRVVNPKTQFSGNFFGFLPKRKTPLPTSGPSRKHNDIGPQSWRVP 151 +VF+V PK + G+FFGFLP R P+P S PSRKHNDIG QS R P Sbjct: 32 NVFKV-KPKYEHKGHFFGFLPGR-IPIPYSSPSRKHNDIGLQSLRSP 76