BLASTX nr result
ID: Atractylodes21_contig00037910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00037910 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA39442.1| TPA: Ras protein ARA-3 [Zea mays] 61 1e-07 ref|XP_004156569.1| PREDICTED: ras-related protein RABE1a-like [... 57 1e-06 ref|XP_004148215.1| PREDICTED: ras-related protein RABE1c-like [... 57 1e-06 ref|XP_004147688.1| PREDICTED: ras-related protein RABE1c-like [... 57 1e-06 ref|XP_004142084.1| PREDICTED: ras-related protein RABE1a-like [... 57 1e-06 >tpg|DAA39442.1| TPA: Ras protein ARA-3 [Zea mays] Length = 228 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 195 SKMAAPPVRARADYDYLIKLLLIGDSGVGK 284 SKMAAPP RARADYDYLIKLLLIGDSGVGK Sbjct: 13 SKMAAPPARARADYDYLIKLLLIGDSGVGK 42 >ref|XP_004156569.1| PREDICTED: ras-related protein RABE1a-like [Cucumis sativus] Length = 221 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 201 MAAPPVRARADYDYLIKLLLIGDSGVGK 284 MAAPP RARADYDYLIKLLLIGDSGVGK Sbjct: 1 MAAPPARARADYDYLIKLLLIGDSGVGK 28 >ref|XP_004148215.1| PREDICTED: ras-related protein RABE1c-like [Cucumis sativus] gi|449528087|ref|XP_004171038.1| PREDICTED: ras-related protein RABE1c-like [Cucumis sativus] Length = 216 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 201 MAAPPVRARADYDYLIKLLLIGDSGVGK 284 MAAPP RARADYDYLIKLLLIGDSGVGK Sbjct: 1 MAAPPARARADYDYLIKLLLIGDSGVGK 28 >ref|XP_004147688.1| PREDICTED: ras-related protein RABE1c-like [Cucumis sativus] gi|449525132|ref|XP_004169573.1| PREDICTED: ras-related protein RABE1c-like [Cucumis sativus] Length = 216 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 201 MAAPPVRARADYDYLIKLLLIGDSGVGK 284 MAAPP RARADYDYLIKLLLIGDSGVGK Sbjct: 1 MAAPPARARADYDYLIKLLLIGDSGVGK 28 >ref|XP_004142084.1| PREDICTED: ras-related protein RABE1a-like [Cucumis sativus] gi|449502574|ref|XP_004161681.1| PREDICTED: ras-related protein RABE1a-like [Cucumis sativus] Length = 216 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 201 MAAPPVRARADYDYLIKLLLIGDSGVGK 284 MAAPP RARADYDYLIKLLLIGDSGVGK Sbjct: 1 MAAPPARARADYDYLIKLLLIGDSGVGK 28