BLASTX nr result
ID: Atractylodes21_contig00037833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00037833 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284244.1| PREDICTED: bidirectional sugar transporter S... 55 8e-06 emb|CAN71371.1| hypothetical protein VITISV_023352 [Vitis vinifera] 55 8e-06 >ref|XP_002284244.1| PREDICTED: bidirectional sugar transporter SWEET10 [Vitis vinifera] gi|297734467|emb|CBI15714.3| unnamed protein product [Vitis vinifera] Length = 270 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/54 (46%), Positives = 37/54 (68%) Frame = -2 Query: 318 DFNIAIPNVLGFILGTVQMILYCVYKNKKIVDVDEKISHFEENINEMEEQKTLV 157 DF IA PN+LGF+ G VQM+LY +Y+N+K V +EK+ E I ++ + T+V Sbjct: 190 DFYIAGPNILGFVFGIVQMVLYLIYRNRKKVLENEKLPELSEQIIDVVKLSTMV 243 >emb|CAN71371.1| hypothetical protein VITISV_023352 [Vitis vinifera] Length = 273 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/54 (46%), Positives = 37/54 (68%) Frame = -2 Query: 318 DFNIAIPNVLGFILGTVQMILYCVYKNKKIVDVDEKISHFEENINEMEEQKTLV 157 DF IA PN+LGF+ G VQM+LY +Y+N+K V +EK+ E I ++ + T+V Sbjct: 190 DFYIAGPNILGFVFGIVQMVLYLIYRNRKKVLENEKLPELSEQIIDVVKLSTMV 243