BLASTX nr result
ID: Atractylodes21_contig00037682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00037682 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530009.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002530009.1| conserved hypothetical protein [Ricinus communis] gi|223530488|gb|EEF32371.1| conserved hypothetical protein [Ricinus communis] Length = 237 Score = 55.8 bits (133), Expect = 3e-06 Identities = 37/87 (42%), Positives = 53/87 (60%), Gaps = 3/87 (3%) Frame = +1 Query: 157 SCNYHHSISKITHQRYASIDGDLKRKVLKQNWRKSRQESLPEPR--LRWRFKCQLSNAP- 327 SC H + +Y+S G K K+ Q+W+ + P+ + L ++ K Q++ P Sbjct: 11 SCQQH-----LLAGQYSS--GKWKAKLKIQDWQCHFLAAEPKSKKPLLFKIKNQMATNPA 63 Query: 328 TYSSRIATDIYLYESPDASFDQYLEDK 408 TYSSRI+TDI +YESP ASFD+YLEDK Sbjct: 64 TYSSRISTDIPIYESPGASFDRYLEDK 90