BLASTX nr result
ID: Atractylodes21_contig00037629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00037629 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22154.3| unnamed protein product [Vitis vinifera] 58 9e-07 ref|XP_002267811.1| PREDICTED: maspardin [Vitis vinifera] 58 9e-07 >emb|CBI22154.3| unnamed protein product [Vitis vinifera] Length = 397 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 1 SWTPSFLPKRCVLTGIPSDPHKQFIADFVDFVVAQ 105 SWTPSFL KR VLTGIP PH+ FIAD VDFVV+Q Sbjct: 149 SWTPSFLLKRYVLTGIPDGPHEPFIADSVDFVVSQ 183 >ref|XP_002267811.1| PREDICTED: maspardin [Vitis vinifera] Length = 407 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 1 SWTPSFLPKRCVLTGIPSDPHKQFIADFVDFVVAQ 105 SWTPSFL KR VLTGIP PH+ FIAD VDFVV+Q Sbjct: 149 SWTPSFLLKRYVLTGIPDGPHEPFIADSVDFVVSQ 183