BLASTX nr result
ID: Atractylodes21_contig00037571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00037571 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533374.1| PREDICTED: uncharacterized protein LOC100812... 68 7e-10 ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808... 65 7e-09 ref|XP_003636545.1| Pentatricopeptide repeat-containing protein ... 64 1e-08 gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 58 7e-07 gb|ACJ85145.1| unknown [Medicago truncatula] gi|388517775|gb|AFK... 57 2e-06 >ref|XP_003533374.1| PREDICTED: uncharacterized protein LOC100812827 [Glycine max] Length = 572 Score = 68.2 bits (165), Expect = 7e-10 Identities = 34/58 (58%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = -1 Query: 205 RNRGFRSLTRTEWEERRRKGLCFRCGLVFGPT-HKCSEGALRVLLLADDEFVTEEGEI 35 R +G RS+ E+EERR KGLCF+CG + PT HKC E ALRVL+L + E +T+EGEI Sbjct: 311 RWKGIRSIHNEEFEERRAKGLCFKCGGKYHPTFHKCLERALRVLILGEGETMTKEGEI 368 >ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808652 [Glycine max] Length = 463 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -1 Query: 199 RGFRSLTRTEWEERRRKGLCFRCGLVFGPT-HKCSEGALRVLLLADDEFVTEEGEIRGHE 23 +G RS+ E ERR KGLCF+CG + PT HKC E ALRVL+L + E + +EGEI E Sbjct: 297 KGVRSIRNNEMAERRAKGLCFKCGGKYHPTLHKCPERALRVLILGEGEALNDEGEIMAME 356 >ref|XP_003636545.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502480|gb|AES83683.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1280 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/58 (56%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -1 Query: 205 RNRGFRSLTRTEWEERRRKGLCFRCGLVFGPT-HKCSEGALRVLLLADDEFVTEEGEI 35 R +G RS+ E ERR KGLCF+CG + PT HKC E +LRVL+L + E V EEGEI Sbjct: 920 RWKGVRSIQNGEMAERRAKGLCFKCGGKYHPTLHKCPEKSLRVLILGEGEGVNEEGEI 977 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/57 (47%), Positives = 38/57 (66%) Frame = -1 Query: 205 RNRGFRSLTRTEWEERRRKGLCFRCGLVFGPTHKCSEGALRVLLLADDEFVTEEGEI 35 R+R F L+ E ER++KGLCF+CG F P H+C + LRVL+L +DE EG++ Sbjct: 92 RDRSFTHLSYNELMERKQKGLCFKCGGPFHPMHQCPDKQLRVLVLEEDEEGEPEGKL 148 >gb|ACJ85145.1| unknown [Medicago truncatula] gi|388517775|gb|AFK46949.1| unknown [Medicago truncatula] Length = 185 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/44 (63%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = -1 Query: 163 ERRRKGLCFRCGLVFGPT-HKCSEGALRVLLLADDEFVTEEGEI 35 ERR KGLCF+CG + PT HKC E +LRVL+L + E V EEGEI Sbjct: 3 ERRAKGLCFKCGGKYHPTLHKCPEKSLRVLILGEGEGVNEEGEI 46