BLASTX nr result
ID: Atractylodes21_contig00037463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00037463 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC84139.1| ferrochelatase [Cichorium intybus] 72 5e-11 >gb|AAC84139.1| ferrochelatase [Cichorium intybus] Length = 218 Score = 72.0 bits (175), Expect = 5e-11 Identities = 39/55 (70%), Positives = 41/55 (74%) Frame = +3 Query: 171 MNAATASCALPAVKHSNLTTSKFNPNSSVVWFHRKLQVPFGSYTCEIKCEASGNS 335 MNAA S ALP VK S LT+SKFN NSSVV FHRK QV S+T IKCEASGNS Sbjct: 1 MNAAATSRALPGVKLSKLTSSKFNHNSSVVSFHRKAQVSLCSHTHAIKCEASGNS 55