BLASTX nr result
ID: Atractylodes21_contig00037443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00037443 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACZ04920.1| argonaute 4-like protein [Pelargonium x hortorum] 62 5e-08 gb|ABC61505.1| AGO4-2, partial [Nicotiana benthamiana] 60 2e-07 gb|ABC61504.1| AGO4-1, partial [Nicotiana benthamiana] 60 2e-07 ref|XP_002275928.1| PREDICTED: protein argonaute 4 [Vitis vinife... 60 2e-07 gb|AFV15381.1| AGO4A [Solanum lycopersicum] 59 4e-07 >gb|ACZ04920.1| argonaute 4-like protein [Pelargonium x hortorum] Length = 933 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +1 Query: 73 LIANQNVKDPYSIDLAKEKHTLKNLKVKTSLTKTE*KITGLSE 201 LIANQN +DP+S+D AK K TLKNL++KTS TE KITGLSE Sbjct: 305 LIANQNARDPFSLDWAKAKRTLKNLRIKTSPANTEYKITGLSE 347 >gb|ABC61505.1| AGO4-2, partial [Nicotiana benthamiana] Length = 905 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 73 LIANQNVKDPYSIDLAKEKHTLKNLKVKTSLTKTE*KITGLSE 201 LIANQN KDPY++D AK K LKNL+VKTS T E KITGLS+ Sbjct: 283 LIANQNAKDPYTLDWAKAKRMLKNLRVKTSPTNQEFKITGLSD 325 >gb|ABC61504.1| AGO4-1, partial [Nicotiana benthamiana] Length = 912 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 73 LIANQNVKDPYSIDLAKEKHTLKNLKVKTSLTKTE*KITGLSE 201 LIANQN KDP+S+D AK K TLKNL+VKT+ E KITGLSE Sbjct: 285 LIANQNAKDPFSLDWAKAKRTLKNLRVKTAPANQEFKITGLSE 327 >ref|XP_002275928.1| PREDICTED: protein argonaute 4 [Vitis vinifera] gi|296083994|emb|CBI24382.3| unnamed protein product [Vitis vinifera] Length = 913 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +1 Query: 73 LIANQNVKDPYSIDLAKEKHTLKNLKVKTSLTKTE*KITGLSE 201 LIANQN +DP+S+D AK K LKNL+VKTS + TE KITGLSE Sbjct: 285 LIANQNARDPFSLDWAKAKKMLKNLRVKTSPSNTEYKITGLSE 327 >gb|AFV15381.1| AGO4A [Solanum lycopersicum] Length = 909 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 73 LIANQNVKDPYSIDLAKEKHTLKNLKVKTSLTKTE*KITGLSE 201 LIANQN KDP+S+D AK K LKNL+VKT+ T E KITGLS+ Sbjct: 283 LIANQNAKDPFSLDWAKAKRVLKNLRVKTTPTNQEYKITGLSD 325