BLASTX nr result
ID: Atractylodes21_contig00037092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00037092 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521564.1| syntaxin, putative [Ricinus communis] gi|223... 59 3e-07 ref|XP_004171656.1| PREDICTED: phosphopantetheine adenylyltransf... 59 5e-07 ref|XP_004134203.1| PREDICTED: phosphopantetheine adenylyltransf... 59 5e-07 emb|CBI39247.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002327686.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002521564.1| syntaxin, putative [Ricinus communis] gi|223539242|gb|EEF40835.1| syntaxin, putative [Ricinus communis] Length = 493 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/37 (78%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = -2 Query: 210 LEHLSISSTISPPNSYG-VVLGGTFDRLHDGHRLFLK 103 LE ++ ISPPNSYG VVLGGTFDRLHDGHRLFLK Sbjct: 4 LEEPMVNHKISPPNSYGAVVLGGTFDRLHDGHRLFLK 40 >ref|XP_004171656.1| PREDICTED: phosphopantetheine adenylyltransferase-like [Cucumis sativus] Length = 178 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/36 (80%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -2 Query: 207 EHLSISSTISPPNSYG-VVLGGTFDRLHDGHRLFLK 103 E +I+ ISPPNSYG VVLGGTFDRLHDGHRLFLK Sbjct: 5 EDSTINYKISPPNSYGAVVLGGTFDRLHDGHRLFLK 40 >ref|XP_004134203.1| PREDICTED: phosphopantetheine adenylyltransferase-like [Cucumis sativus] Length = 178 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/36 (80%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -2 Query: 207 EHLSISSTISPPNSYG-VVLGGTFDRLHDGHRLFLK 103 E +I+ ISPPNSYG VVLGGTFDRLHDGHRLFLK Sbjct: 5 EDSTINYKISPPNSYGAVVLGGTFDRLHDGHRLFLK 40 >emb|CBI39247.3| unnamed protein product [Vitis vinifera] Length = 372 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 1/30 (3%) Frame = -2 Query: 189 STISPPNSYG-VVLGGTFDRLHDGHRLFLK 103 S ISPPNS+G VVLGGTFDRLHDGHRLFLK Sbjct: 113 SNISPPNSHGAVVLGGTFDRLHDGHRLFLK 142 >ref|XP_002327686.1| predicted protein [Populus trichocarpa] gi|222836771|gb|EEE75164.1| predicted protein [Populus trichocarpa] Length = 178 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -2 Query: 213 SLEHLSISSTISPPNSYG-VVLGGTFDRLHDGHRLFLK 103 ++E +++ +SPPNSY VVLGGTFDRLHDGHRLFLK Sbjct: 3 TVEESVVNTKLSPPNSYSAVVLGGTFDRLHDGHRLFLK 40