BLASTX nr result
ID: Atractylodes21_contig00036973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00036973 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEF13372.1| Dof-domain transcription factor protein [Platycod... 64 1e-08 >gb|AEF13372.1| Dof-domain transcription factor protein [Platycodon grandiflorus] Length = 162 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = -3 Query: 164 MADVHKGHDSTGIKLFGKMINVQVMRELKEEPVNKSEVDDEDQTLVNKRPDKII 3 MADVH GHDS GIKLFGK I VQV++++K+EP NK+ D+ + KRPDKII Sbjct: 1 MADVHNGHDSPGIKLFGKTITVQVIKDIKDEP-NKA-----DEEALEKRPDKII 48