BLASTX nr result
ID: Atractylodes21_contig00036631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00036631 (505 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_683481.1| uncharacterized protein [Arabidopsis thaliana] ... 55 6e-06 >ref|NP_683481.1| uncharacterized protein [Arabidopsis thaliana] gi|297841483|ref|XP_002888623.1| hypothetical protein ARALYDRAFT_475883 [Arabidopsis lyrata subsp. lyrata] gi|17528968|gb|AAL38694.1| unknown protein [Arabidopsis thaliana] gi|20465479|gb|AAM20199.1| unknown protein [Arabidopsis thaliana] gi|21618233|gb|AAM67283.1| unknown [Arabidopsis thaliana] gi|26450708|dbj|BAC42463.1| unknown protein [Arabidopsis thaliana] gi|297334464|gb|EFH64882.1| hypothetical protein ARALYDRAFT_475883 [Arabidopsis lyrata subsp. lyrata] gi|332196574|gb|AEE34695.1| uncharacterized protein [Arabidopsis thaliana] Length = 63 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -1 Query: 187 LHQDEKQERMEKEAEIRRVREQLLQENKDRDPIA 86 LHQDEKQERMEKEAE+RRVR +LL++ ++ DP+A Sbjct: 30 LHQDEKQERMEKEAEVRRVRAELLRKAREEDPLA 63