BLASTX nr result
ID: Atractylodes21_contig00036527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00036527 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_181818.1| basic secretory protein (BSP) family protein [A... 56 4e-06 emb|CBI22118.3| unnamed protein product [Vitis vinifera] 55 8e-06 >ref|NP_181818.1| basic secretory protein (BSP) family protein [Arabidopsis thaliana] gi|4512665|gb|AAD21719.1| unknown protein [Arabidopsis thaliana] gi|20197864|gb|AAM15288.1| unknown protein [Arabidopsis thaliana] gi|46931222|gb|AAT06415.1| At2g42900 [Arabidopsis thaliana] gi|48310431|gb|AAT41819.1| At2g42900 [Arabidopsis thaliana] gi|330255091|gb|AEC10185.1| basic secretory protein (BSP) family protein [Arabidopsis thaliana] Length = 276 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = -2 Query: 153 TSVDPNTILGVILISFIGIIAIWANHEASKGFSITIVNDAGKYSLPGKRFS 1 T D IL + I +G I++WANHEASKGFSI+I+NDA K S GKRF+ Sbjct: 24 TESDSGIILRLFSILLVGAISLWANHEASKGFSISIINDA-KDSPSGKRFA 73 >emb|CBI22118.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -2 Query: 126 GVILISFIGIIAIWANHEASKGFSITIVNDAGKYSLPGKRF 4 GV+ + FIGI+ IWAN EASKGFSITI+NDAG + G++F Sbjct: 18 GVLSVFFIGIVTIWANCEASKGFSITIINDAGD-TAAGRKF 57