BLASTX nr result
ID: Atractylodes21_contig00036431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00036431 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67762.1| hypothetical protein VITISV_040650 [Vitis vinifera] 55 8e-06 >emb|CAN67762.1| hypothetical protein VITISV_040650 [Vitis vinifera] Length = 1316 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/62 (40%), Positives = 38/62 (61%) Frame = +3 Query: 24 VALPNGSTFFVEHIGTVLLSSKLCLYQVLFVPTLHCNLLSVARFTTQYQSTLHFTNSYCY 203 V LP+G+ +G V LS LCL VL+VP+L CNL+S+ + + + FT+S+C Sbjct: 288 VGLPDGTKTVANEMGYVKLSKDLCLKNVLYVPSLKCNLISIGQLLKEKDYIVTFTDSFCV 347 Query: 204 MQ 209 +Q Sbjct: 348 IQ 349