BLASTX nr result
ID: Atractylodes21_contig00036294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00036294 (533 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319813.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002317579.1| predicted protein [Populus trichocarpa] gi|2... 59 6e-07 ref|XP_003540414.1| PREDICTED: TBC1 domain family member 15-like... 57 2e-06 emb|CBI23941.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002281703.1| PREDICTED: uncharacterized protein LOC100250... 56 3e-06 >ref|XP_002319813.1| predicted protein [Populus trichocarpa] gi|222858189|gb|EEE95736.1| predicted protein [Populus trichocarpa] Length = 488 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 444 LWKDPGLPTDSYYEVRAECTDVPKTKFKIK 533 +W+DPG P DSYY+VR ECTDVPKT+FKIK Sbjct: 1 MWRDPGQPADSYYQVRPECTDVPKTRFKIK 30 >ref|XP_002317579.1| predicted protein [Populus trichocarpa] gi|222860644|gb|EEE98191.1| predicted protein [Populus trichocarpa] Length = 467 Score = 58.5 bits (140), Expect = 6e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 444 LWKDPGLPTDSYYEVRAECTDVPKTKFKIK 533 +W+DPG P DSYY+VR ECTDVPK+KFKIK Sbjct: 1 MWRDPGQPADSYYQVRPECTDVPKSKFKIK 30 >ref|XP_003540414.1| PREDICTED: TBC1 domain family member 15-like [Glycine max] Length = 422 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 444 LWKDPGLPTDSYYEVRAECTDVPKTKFKIK 533 +W+DPG+P DS+YE+R ECTDVP T+FKIK Sbjct: 1 MWRDPGVPADSFYEIRPECTDVPVTRFKIK 30 >emb|CBI23941.3| unnamed protein product [Vitis vinifera] Length = 426 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 444 LWKDPGLPTDSYYEVRAECTDVPKTKFKIK 533 +W D G PTDS+YEVRAEC+DVPKT+FKIK Sbjct: 1 MWFDTGAPTDSFYEVRAECSDVPKTRFKIK 30 >ref|XP_002281703.1| PREDICTED: uncharacterized protein LOC100250247 [Vitis vinifera] Length = 450 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 444 LWKDPGLPTDSYYEVRAECTDVPKTKFKIK 533 +W D G PTDS+YEVRAEC+DVPKT+FKIK Sbjct: 1 MWFDTGAPTDSFYEVRAECSDVPKTRFKIK 30