BLASTX nr result
ID: Atractylodes21_contig00036034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00036034 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD26956.1| hypothetical protein [Arabidopsis thaliana] gi|61... 57 1e-06 >gb|AAD26956.1| hypothetical protein [Arabidopsis thaliana] gi|61676918|gb|AAP21683.2| hypothetical protein [Arabidopsis thaliana] gi|93007352|gb|ABE97179.1| unknown [Arabidopsis thaliana] Length = 311 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/62 (41%), Positives = 38/62 (61%) Frame = +3 Query: 210 WDTKEDIALMSAWAFVSEDATRGKNQKKGALFSRVKKYYDAAREENPEGMRERNENQMKG 389 W KED+ L+S+W S+DA G QK +SR+ YYDA+ + N G+R+R + +K Sbjct: 60 WSAKEDMVLVSSWLNTSKDAVIGNEQKANTFWSRIAAYYDASPQLN--GLRKRMQGNIKQ 117 Query: 390 RW 395 RW Sbjct: 118 RW 119