BLASTX nr result
ID: Atractylodes21_contig00035995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00035995 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277730.1| PREDICTED: uncharacterized protein LOC100247... 62 4e-08 >ref|XP_002277730.1| PREDICTED: uncharacterized protein LOC100247308 [Vitis vinifera] gi|297738542|emb|CBI27787.3| unnamed protein product [Vitis vinifera] Length = 519 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +2 Query: 236 LRMKQLSLFFLVFVCASIVVWNWEKTPRLTTLLPPHDQVLQVF 364 LR KQLSL LV VC +I++W WEKTP LTTLLPP +++LQ++ Sbjct: 8 LRGKQLSLILLVLVCTTILIWAWEKTPLLTTLLPPQNRLLQLY 50