BLASTX nr result
ID: Atractylodes21_contig00035841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00035841 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526975.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 >ref|XP_002526975.1| conserved hypothetical protein [Ricinus communis] gi|223533666|gb|EEF35402.1| conserved hypothetical protein [Ricinus communis] Length = 576 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 3/81 (3%) Frame = -3 Query: 239 QQGKYVRARENPFFDGLRRGNTSMINRASLRDFRGKSGKQKISRSVSAIGH---KEYTGD 69 QQ Y+R RENP+F GLRRG+ + N+ DF+G + ISR+ S I H K++ D Sbjct: 11 QQEPYIRTRENPYFTGLRRGDIASRNQTPTLDFQGNDASRNISRTTSEISHARSKDFIQD 70 Query: 68 IPENVSYSSSKGSQLNIRQEP 6 I E + S + S +I P Sbjct: 71 ISEKSNDSLLEDSVSDIVLNP 91