BLASTX nr result
ID: Atractylodes21_contig00035737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00035737 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530420.1| Oligopeptide transporter, putative [Ricinus ... 82 3e-14 ref|XP_002269139.2| PREDICTED: oligopeptide transporter 5-like, ... 78 7e-13 ref|XP_002329927.1| oligopeptide transporter OPT family [Populus... 78 7e-13 ref|XP_002323113.1| oligopeptide transporter OPT family [Populus... 78 7e-13 ref|XP_002445962.1| hypothetical protein SORBIDRAFT_07g028740 [S... 75 4e-12 >ref|XP_002530420.1| Oligopeptide transporter, putative [Ricinus communis] gi|223530028|gb|EEF31951.1| Oligopeptide transporter, putative [Ricinus communis] Length = 672 Score = 82.4 bits (202), Expect = 3e-14 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = -3 Query: 495 MAILCYLVLQNRNINGPEWWGLEVDDHCPLANCPSLPGIHVEGCPVV 355 +AILCY LQ ++INGP WWGLE+DDHCPLA CP+ PGI +GCPV+ Sbjct: 626 LAILCYFTLQLKDINGPAWWGLELDDHCPLATCPTAPGIVADGCPVL 672 >ref|XP_002269139.2| PREDICTED: oligopeptide transporter 5-like, partial [Vitis vinifera] Length = 408 Score = 78.2 bits (191), Expect = 7e-13 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = -3 Query: 495 MAILCYLVLQNRNINGPEWWGLEVDDHCPLANCPSLPGIHVEGCPV 358 MAIL Y LQ+++ING +WWGL +DDHCPLA+CP+ P I VEGCPV Sbjct: 361 MAILSYFTLQDKDINGMQWWGLGIDDHCPLAHCPTAPAIKVEGCPV 406 >ref|XP_002329927.1| oligopeptide transporter OPT family [Populus trichocarpa] gi|222871949|gb|EEF09080.1| oligopeptide transporter OPT family [Populus trichocarpa] Length = 727 Score = 78.2 bits (191), Expect = 7e-13 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = -3 Query: 495 MAILCYLVLQNRNINGPEWWGLEVDDHCPLANCPSLPGIHVEGCPV 358 +AIL Y LQ ++INGP WWGLE+ DHCPLA CP+ PG VEGCPV Sbjct: 680 LAILLYFTLQIKDINGPTWWGLELSDHCPLATCPTAPGFQVEGCPV 725 >ref|XP_002323113.1| oligopeptide transporter OPT family [Populus trichocarpa] gi|222867743|gb|EEF04874.1| oligopeptide transporter OPT family [Populus trichocarpa] Length = 748 Score = 78.2 bits (191), Expect = 7e-13 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = -3 Query: 495 MAILCYLVLQNRNINGPEWWGLEVDDHCPLANCPSLPGIHVEGCPV 358 +AIL Y LQ ++INGP WWGLE+ DHCPLA CP+ PG VEGCPV Sbjct: 701 LAILLYFTLQIKDINGPTWWGLELSDHCPLATCPTAPGFQVEGCPV 746 >ref|XP_002445962.1| hypothetical protein SORBIDRAFT_07g028740 [Sorghum bicolor] gi|241942312|gb|EES15457.1| hypothetical protein SORBIDRAFT_07g028740 [Sorghum bicolor] Length = 761 Score = 75.5 bits (184), Expect = 4e-12 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 495 MAILCYLVLQNRNINGPEWWGLEVDDHCPLANCPSLPGIHVEGCPV 358 MAI+ Y VLQ+R +NG +WWGL+VDDHC LA CP+ PGI GCPV Sbjct: 715 MAIVSYAVLQSRGVNGVDWWGLQVDDHCALARCPTAPGISAPGCPV 760