BLASTX nr result
ID: Atractylodes21_contig00035557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00035557 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277178.1| PREDICTED: solute carrier family 35 member B... 64 1e-08 gb|ACO60591.1| UDP-galactose transporter 3-like protein [Heliant... 64 2e-08 gb|ACO60577.1| UDP-galactose transporter 3-like protein [Heliant... 64 2e-08 ref|XP_003519036.1| PREDICTED: solute carrier family 35 member B... 62 5e-08 ref|XP_002323090.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 >ref|XP_002277178.1| PREDICTED: solute carrier family 35 member B1 [Vitis vinifera] gi|296086405|emb|CBI31994.3| unnamed protein product [Vitis vinifera] Length = 332 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 1 IVVSSLLSGNPLSRKQWGSVAMVFSGLSYQIYL 99 IVVSSLLSGNPLS KQWGSV+MVFSGLSYQIYL Sbjct: 285 IVVSSLLSGNPLSAKQWGSVSMVFSGLSYQIYL 317 >gb|ACO60591.1| UDP-galactose transporter 3-like protein [Helianthus annuus] Length = 49 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 IVVSSLLSGNPLSRKQWGSVAMVFSGLSYQIYL 99 IVVSS++SGNPLSRKQWGSV MVFSGLSYQIYL Sbjct: 16 IVVSSVVSGNPLSRKQWGSVVMVFSGLSYQIYL 48 >gb|ACO60577.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514429|gb|ACO60578.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514431|gb|ACO60579.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514433|gb|ACO60580.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514435|gb|ACO60581.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514437|gb|ACO60582.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514439|gb|ACO60583.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514441|gb|ACO60584.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514443|gb|ACO60585.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514445|gb|ACO60586.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514447|gb|ACO60587.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514449|gb|ACO60588.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514451|gb|ACO60589.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514453|gb|ACO60590.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514457|gb|ACO60592.1| UDP-galactose transporter 3-like protein [Helianthus annuus] gi|226514459|gb|ACO60593.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] gi|226514461|gb|ACO60594.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] gi|226514463|gb|ACO60595.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] gi|226514465|gb|ACO60596.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] gi|226514467|gb|ACO60597.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] gi|226514469|gb|ACO60598.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] gi|226514471|gb|ACO60599.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] gi|226514473|gb|ACO60600.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] gi|226514475|gb|ACO60601.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] gi|226514477|gb|ACO60602.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] gi|226514479|gb|ACO60603.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] gi|226514481|gb|ACO60604.1| UDP-galactose transporter 3-like protein [Helianthus petiolaris] Length = 49 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 IVVSSLLSGNPLSRKQWGSVAMVFSGLSYQIYL 99 IVVSS++SGNPLSRKQWGSV MVFSGLSYQIYL Sbjct: 16 IVVSSVVSGNPLSRKQWGSVVMVFSGLSYQIYL 48 >ref|XP_003519036.1| PREDICTED: solute carrier family 35 member B1-like [Glycine max] Length = 330 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 1 IVVSSLLSGNPLSRKQWGSVAMVFSGLSYQIYL 99 IVVSSLLSGNPLS KQWG V+MVFSGLSYQIYL Sbjct: 283 IVVSSLLSGNPLSTKQWGCVSMVFSGLSYQIYL 315 >ref|XP_002323090.1| predicted protein [Populus trichocarpa] gi|222867720|gb|EEF04851.1| predicted protein [Populus trichocarpa] Length = 332 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 1 IVVSSLLSGNPLSRKQWGSVAMVFSGLSYQIYL 99 IVVSS+LSGNPLS KQWG VAMVFSGLSYQIYL Sbjct: 285 IVVSSVLSGNPLSAKQWGCVAMVFSGLSYQIYL 317