BLASTX nr result
ID: Atractylodes21_contig00035373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00035373 (771 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38626.3| unnamed protein product [Vitis vinifera] 67 4e-09 ref|XP_002264821.2| PREDICTED: ubiquinol-cytochrome c reductase ... 63 8e-08 ref|XP_004148644.1| PREDICTED: ubiquinol-cytochrome c reductase ... 56 7e-06 >emb|CBI38626.3| unnamed protein product [Vitis vinifera] Length = 354 Score = 67.0 bits (162), Expect = 4e-09 Identities = 40/104 (38%), Positives = 56/104 (53%) Frame = -3 Query: 313 QITVNVIAMAPPWSRTLANMYRVGRQKKSEVTRDVSCFSFQSISRVASFKVPIAPGSTGK 134 QI V + M P WSR +Y++G Q E+ +D + +S ++VA+ A ST K Sbjct: 62 QIKVRWLTMLPRWSRAAIRLYKLGSQNNMELRKDFCFVASRSYAKVAA----AADDSTEK 117 Query: 133 SYAAKSEGQALEQLVNLNKMFRTKPSSLALPPGSPKRINEPNYE 2 +++ K E V NKMF +KP SLAL SP R+ EP YE Sbjct: 118 NFSRKPE-------VYFNKMFWSKPCSLALAQDSPLRVEEPKYE 154 >ref|XP_002264821.2| PREDICTED: ubiquinol-cytochrome c reductase complex chaperone CBP3 homolog [Vitis vinifera] Length = 285 Score = 62.8 bits (151), Expect = 8e-08 Identities = 37/96 (38%), Positives = 52/96 (54%) Frame = -3 Query: 289 MAPPWSRTLANMYRVGRQKKSEVTRDVSCFSFQSISRVASFKVPIAPGSTGKSYAAKSEG 110 M P WSR +Y++G Q E+ +D + +S ++VA+ A ST K+++ K E Sbjct: 1 MLPRWSRAAIRLYKLGSQNNMELRKDFCFVASRSYAKVAA----AADDSTEKNFSRKPE- 55 Query: 109 QALEQLVNLNKMFRTKPSSLALPPGSPKRINEPNYE 2 V NKMF +KP SLAL SP R+ EP YE Sbjct: 56 ------VYFNKMFWSKPCSLALAQDSPLRVEEPKYE 85 >ref|XP_004148644.1| PREDICTED: ubiquinol-cytochrome c reductase complex chaperone CBP3 homolog [Cucumis sativus] gi|449516820|ref|XP_004165444.1| PREDICTED: ubiquinol-cytochrome c reductase complex chaperone CBP3 homolog [Cucumis sativus] Length = 290 Score = 56.2 bits (134), Expect = 7e-06 Identities = 34/96 (35%), Positives = 52/96 (54%) Frame = -3 Query: 289 MAPPWSRTLANMYRVGRQKKSEVTRDVSCFSFQSISRVASFKVPIAPGSTGKSYAAKSEG 110 M WSR ++ R+G + + + D+ +S ++VA+ P + G S S G Sbjct: 1 MLAKWSRVTRHLSRIGLESNFKFSTDLHVCPHRSYAKVAAAAAP----NIGHSEKGVSGG 56 Query: 109 QALEQLVNLNKMFRTKPSSLALPPGSPKRINEPNYE 2 +V+L+KMF +KP SLALP SP R++EP YE Sbjct: 57 H----VVHLDKMFLSKPCSLALPKDSPLRMDEPQYE 88