BLASTX nr result
ID: Atractylodes21_contig00035290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00035290 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531176.1| nucleic acid binding protein, putative [Rici... 58 7e-07 >ref|XP_002531176.1| nucleic acid binding protein, putative [Ricinus communis] gi|223529246|gb|EEF31219.1| nucleic acid binding protein, putative [Ricinus communis] Length = 231 Score = 58.2 bits (139), Expect = 7e-07 Identities = 34/68 (50%), Positives = 42/68 (61%), Gaps = 4/68 (5%) Frame = -1 Query: 270 NGSPLALWRYPNAQNS-TFNRDHLINPSPLVSSSSHDGLRASRIPTTSS---YMYDSKPS 103 NGSPL LWR P +S T +RD +NP PL S L+ S++ +SS Y Y+ KPS Sbjct: 164 NGSPLGLWRIPTVHSSATLHRDRSMNPLPLFSGEE---LKLSQVGGSSSQGRYGYEGKPS 220 Query: 102 VQDQVSLD 79 VQD VSLD Sbjct: 221 VQDHVSLD 228