BLASTX nr result
ID: Atractylodes21_contig00035275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00035275 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB84352.1| lipoxygenase [Citrus jambhiri] 73 3e-11 ref|NP_001234259.1| lipoxygenase [Solanum lycopersicum] gi|22301... 68 7e-10 gb|AAT77551.1| LoxC-like [Solanum pimpinellifolium] 68 7e-10 emb|CAA05280.1| loxc homologue [Solanum lycopersicum] 68 7e-10 emb|CAA05277.1| loxc homologue [Solanum pimpinellifolium] 68 7e-10 >dbj|BAB84352.1| lipoxygenase [Citrus jambhiri] Length = 895 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 322 IDSRNHDPNLRNRSGAGLVPYQLLKPFFEPGATGKGVLYNISI 194 ID+RN DP LRNR+GAG+VPY+LLKPF EPG TGKGV Y+ISI Sbjct: 853 IDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVPYSISI 895 >ref|NP_001234259.1| lipoxygenase [Solanum lycopersicum] gi|223016547|gb|ACM77790.1| lipoxygenase [Solanum lycopersicum] Length = 902 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -1 Query: 322 IDSRNHDPNLRNRSGAGLVPYQLLKPFFEPGATGKGVLYNISI 194 ID+RN D NL+NR+GAG++PY+LLKPF EPG TGKGV Y+ISI Sbjct: 860 IDARNADCNLKNRNGAGVMPYELLKPFSEPGITGKGVPYSISI 902 >gb|AAT77551.1| LoxC-like [Solanum pimpinellifolium] Length = 247 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -1 Query: 322 IDSRNHDPNLRNRSGAGLVPYQLLKPFFEPGATGKGVLYNISI 194 ID+RN D NL+NR+GAG++PY+LLKPF EPG TGKGV Y+ISI Sbjct: 205 IDARNADCNLKNRNGAGVMPYELLKPFSEPGITGKGVPYSISI 247 >emb|CAA05280.1| loxc homologue [Solanum lycopersicum] Length = 442 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -1 Query: 322 IDSRNHDPNLRNRSGAGLVPYQLLKPFFEPGATGKGVLYNISI 194 ID+RN D NL+NR+GAG++PY+LLKPF EPG TGKGV Y+ISI Sbjct: 400 IDARNADCNLKNRNGAGVMPYELLKPFSEPGITGKGVPYSISI 442 >emb|CAA05277.1| loxc homologue [Solanum pimpinellifolium] Length = 341 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -1 Query: 322 IDSRNHDPNLRNRSGAGLVPYQLLKPFFEPGATGKGVLYNISI 194 ID+RN D NL+NR+GAG++PY+LLKPF EPG TGKGV Y+ISI Sbjct: 299 IDARNADCNLKNRNGAGVMPYELLKPFSEPGITGKGVPYSISI 341