BLASTX nr result
ID: Atractylodes21_contig00035212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00035212 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529632.1| PREDICTED: tRNA wybutosine-synthesizing prot... 75 4e-12 emb|CBI23243.3| unnamed protein product [Vitis vinifera] 75 4e-12 ref|XP_002268884.1| PREDICTED: tRNA wybutosine-synthesizing prot... 75 4e-12 ref|XP_003610434.1| tRNA wybutosine-synthesizing protein 2/3/4 [... 75 7e-12 ref|XP_004155603.1| PREDICTED: tRNA wybutosine-synthesizing prot... 74 1e-11 >ref|XP_003529632.1| PREDICTED: tRNA wybutosine-synthesizing protein 2/3/4-like [Glycine max] Length = 1068 Score = 75.5 bits (184), Expect = 4e-12 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +2 Query: 2 SIKAISISEGYNWDVSIEHVERVKWYAPHIRHLVADIRCKKIE 130 SI I+ SEGY W+VSIEHVERVKWYAPHIRH+VAD+RC++I+ Sbjct: 1025 SIYDIARSEGYTWEVSIEHVERVKWYAPHIRHVVADVRCRQIQ 1067 >emb|CBI23243.3| unnamed protein product [Vitis vinifera] Length = 1013 Score = 75.5 bits (184), Expect = 4e-12 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = +2 Query: 2 SIKAISISEGYNWDVSIEHVERVKWYAPHIRHLVADIRCKKIE 130 SI ++ SEGY+W+VS+EHVERVKWYAPHIRHLVAD+RC++I+ Sbjct: 970 SICDLARSEGYDWEVSVEHVERVKWYAPHIRHLVADVRCRQIQ 1012 >ref|XP_002268884.1| PREDICTED: tRNA wybutosine-synthesizing protein 2/3/4-like [Vitis vinifera] Length = 1018 Score = 75.5 bits (184), Expect = 4e-12 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = +2 Query: 2 SIKAISISEGYNWDVSIEHVERVKWYAPHIRHLVADIRCKKIE 130 SI ++ SEGY+W+VS+EHVERVKWYAPHIRHLVAD+RC++I+ Sbjct: 975 SICDLARSEGYDWEVSVEHVERVKWYAPHIRHLVADVRCRQIQ 1017 >ref|XP_003610434.1| tRNA wybutosine-synthesizing protein 2/3/4 [Medicago truncatula] gi|355511489|gb|AES92631.1| tRNA wybutosine-synthesizing protein 2/3/4 [Medicago truncatula] Length = 1046 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +2 Query: 2 SIKAISISEGYNWDVSIEHVERVKWYAPHIRHLVADIRCKKIE 130 SI I+ SEGY W+V+IEHVERVKWYAPHIRH+VAD+RCK+I+ Sbjct: 1003 SIYEIARSEGYCWEVTIEHVERVKWYAPHIRHVVADVRCKQIQ 1045 >ref|XP_004155603.1| PREDICTED: tRNA wybutosine-synthesizing protein 2/3/4-like [Cucumis sativus] Length = 1035 Score = 73.9 bits (180), Expect = 1e-11 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = +2 Query: 2 SIKAISISEGYNWDVSIEHVERVKWYAPHIRHLVADIRCKKIE 130 SI I+ SEG+ WD++IEH+ERVKWYAPHIRHLVAD++CK+I+ Sbjct: 990 SITEIAKSEGHCWDITIEHIERVKWYAPHIRHLVADVQCKRIQ 1032