BLASTX nr result
ID: Atractylodes21_contig00035121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00035121 (868 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323718.1| predicted protein [Populus trichocarpa] gi|2... 102 1e-19 ref|XP_002532392.1| UDP-glucosyltransferase, putative [Ricinus c... 79 1e-12 ref|XP_002532389.1| UDP-glucosyltransferase, putative [Ricinus c... 78 3e-12 gb|AAM12787.1| putative anthocyanidine rhamnosyl-transferase [Ca... 75 2e-11 ref|XP_002527371.1| UDP-glucosyltransferase, putative [Ricinus c... 75 3e-11 >ref|XP_002323718.1| predicted protein [Populus trichocarpa] gi|222866720|gb|EEF03851.1| predicted protein [Populus trichocarpa] Length = 465 Score = 102 bits (253), Expect = 1e-19 Identities = 43/99 (43%), Positives = 67/99 (67%) Frame = +3 Query: 6 PFEKLLQNDTPHLILIDFSPYWVPQVAAKFGVSTAFFSVYTAATLAYMGPPDELRWGHRR 185 PFE L+Q + P +IL DF+ W+P +AA++G+++ FFS +AA+ AY+GPPDEL R Sbjct: 99 PFESLVQKEAPEMILFDFAACWIPAIAARYGITSVFFSPLSAASSAYLGPPDELHSFRLR 158 Query: 186 KTPQAFTVAPDWFTFHSLVSHRPDYAPTMLRNLHFPDES 302 P+ + AP+W F SLV++RPD +++++ PD S Sbjct: 159 TRPEDYARAPEWIPFPSLVAYRPDQGTRYMQHVYIPDVS 197 >ref|XP_002532392.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223527916|gb|EEF30004.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 471 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/82 (43%), Positives = 50/82 (60%) Frame = +3 Query: 6 PFEKLLQNDTPHLILIDFSPYWVPQVAAKFGVSTAFFSVYTAATLAYMGPPDELRWGHRR 185 P K L+ PH +L DF+PYW+P VA G+S AFFS++ AA+L+++ P W R Sbjct: 101 PLTKFLETSDPHWLLYDFAPYWLPDVAKNLGISNAFFSIFLAASLSFVKPHS---WIEYR 157 Query: 186 KTPQAFTVAPDWFTFHSLVSHR 251 P+ FTV P W +F S V+ R Sbjct: 158 SKPEDFTVPPKWVSFPSKVTFR 179 >ref|XP_002532389.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223527913|gb|EEF30001.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 433 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 1/83 (1%) Frame = +3 Query: 6 PFEKLLQNDTPHLILIDFSPYWVPQVAAKFGVSTAFFSVYTAATLAYMGPPDELRWG-HR 182 P LL++ P +L DF+PYW+P VAAK G+ +AFF++ TA +A++GP L G Sbjct: 64 PMTHLLESLAPDWVLFDFAPYWIPSVAAKLGIKSAFFTICTATMVAFLGPSSLLINGDDD 123 Query: 183 RKTPQAFTVAPDWFTFHSLVSHR 251 RK + FTV P W TF S +++R Sbjct: 124 RKKLEDFTVPPKWVTFPSTIAYR 146 >gb|AAM12787.1| putative anthocyanidine rhamnosyl-transferase [Capsicum annuum] Length = 470 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/78 (43%), Positives = 49/78 (62%), Gaps = 1/78 (1%) Frame = +3 Query: 15 KLLQNDTPHLILIDFSPYWVPQVAAKFGVSTAFFSVYTAATLAYMGPPDELRWGHR-RKT 191 K L++ P I DF+ YWVP VA+KF + TA+FS++ AA L + GP L + RKT Sbjct: 105 KFLEDSAPDFIFFDFTSYWVPSVASKFNIPTAYFSIFIAAFLGFAGPVPGLNNDYEIRKT 164 Query: 192 PQAFTVAPDWFTFHSLVS 245 P+ +TV P W +F + V+ Sbjct: 165 PEEYTVPPKWVSFETTVA 182 >ref|XP_002527371.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223533290|gb|EEF35043.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 470 Score = 74.7 bits (182), Expect = 3e-11 Identities = 31/83 (37%), Positives = 53/83 (63%), Gaps = 1/83 (1%) Frame = +3 Query: 3 APFEKLLQNDTPHLILIDFSPYWVPQVAAKFGVSTAFFSVYTAATLAYMGPPD-ELRWGH 179 +P L+ P ++ D++ +W+P +A+K G+S+AFFS++TAATL+++GPP + G Sbjct: 100 SPLATFLETKKPDWVIYDYASHWLPSIASKVGISSAFFSLFTAATLSFIGPPSLTMNGGD 159 Query: 180 RRKTPQAFTVAPDWFTFHSLVSH 248 R T + FT+ P W F S + + Sbjct: 160 LRLTAEDFTIVPRWVPFESNIKY 182